Recombinant Salmonella agona p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SeAg_B3556; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEASRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of AaeA in Salmonella agona?

AaeA functions as a membrane fusion protein that forms an efflux pump with AaeB in Salmonella agona. This system is primarily responsible for exporting aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), from bacterial cells. The AaeA-AaeB complex serves as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism by preventing the accumulation of potentially harmful aromatic carboxylic acids within the cell . The protein belongs to the membrane fusion protein (MFP) (TC 8.A.1) family and contains 310 amino acids with a molecular weight of approximately 34.6 kDa .

How is AaeA gene expression regulated in bacteria?

Expression of the aaeA gene (previously known as yhcQ) is regulated by AaeR (formerly yhcS), a LysR family transcriptional regulator. Experiments with E. coli demonstrated that AaeR functions as a positive transcription factor for the aaeXAB operon . The expression is induced by the presence of aromatic carboxylic acids, with pHBA being a potent inducer. In E. coli strain MG1655 carrying an aaeRQP-luxCDABE gene fusion, treatment with 12.5 mM pHBA increased expression 30.8-fold compared to untreated cells. Other compounds like sodium salicylate (6.2 mM) induced expression 77-fold, while sodium benzoate (12.5 mM) increased expression 12-fold .

What sequencing approaches are most effective for characterizing multidrug-resistant Salmonella Agona isolates carrying AaeA?

For comprehensive characterization of multidrug-resistant Salmonella Agona isolates, a combined approach of long-read and short-read sequencing is most effective. Studies have successfully employed this dual methodology to assemble complete genomes including chromosomes and plasmids .

Short-read sequencing using Illumina platforms (e.g., MiSeq or NextSeq) provides high accuracy for SNP detection and basic genomic characterization. Libraries can be prepared using kits such as the sparQ DNA Frag & Library Prep Kit (Quantabio) or the Nextera DNA Flex Library Prep Kit (Illumina). For MiSeq, paired-end sequencing in 2 × 151 bp cycles using MiSeq Reagent Kit v3 (600 cycle) is recommended. On NextSeq, paired-end sequencing in 2 × 151 bp using the NextSeq 500/550 Mid Output Kit v2.5 (300 Cycles) has proven effective .

Long-read sequencing using Oxford Nanopore Technologies (ONT) MinION devices complements short-read data by resolving complex genomic regions and enabling complete assembly of plasmids that often carry resistance genes. This approach is particularly valuable for identifying mobile genetic elements associated with antimicrobial resistance genes .

Bioinformatic analysis should employ pipelines like BakCharak (version 3.0.4 or later) with species-specific options and tools including NCBI AMRFinderPlus for antimicrobial resistance gene identification, ABRicate with CGE PlasmidFinder for plasmid classification, and VFDB for virulence factor detection .

How can recombinant AaeA protein be optimally expressed and purified for functional studies?

For optimal expression and purification of recombinant Salmonella agona AaeA:

  • Expression System Selection: E. coli is the preferred heterologous expression system for AaeA, as demonstrated in multiple studies .

  • Vector Design: Incorporate an N-terminal His-tag to facilitate purification through affinity chromatography. The full-length protein (amino acids 1-310) should be expressed with appropriate regulatory elements .

  • Expression Conditions:

    • Culture in rich media (e.g., LB broth) at 37°C until mid-log phase

    • Induce with IPTG (0.5-1.0 mM)

    • Continue expression at a reduced temperature (18-25°C) for 4-16 hours to promote proper folding

  • Purification Strategy:

    • Lyse cells using mechanical disruption (sonication or homogenization)

    • Solubilize membrane-associated proteins with appropriate detergents (e.g., DDM or LDAO)

    • Purify using Ni-NTA affinity chromatography

    • Further purify using size-exclusion chromatography if necessary

  • Storage Conditions: Store in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose. For long-term storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

Protein quality should be assessed by SDS-PAGE (>90% purity) and functional assays to confirm activity .

What experimental approaches are most effective for studying AaeA's role in antimicrobial resistance?

To investigate AaeA's role in antimicrobial resistance, several complementary approaches are recommended:

  • Gene Knockout and Complementation Studies:

    • Generate aaeA deletion mutants using CRISPR-Cas9 or lambda Red recombinase-based techniques

    • Assess susceptibility to antimicrobial compounds in wildtype vs. mutant strains

    • Complement mutants with plasmid-expressed aaeA to confirm phenotype restoration

    Research with E. coli demonstrated that yhcP (aaeB) mutant strains exhibited hypersensitivity to pHBA, confirming its role in efflux function .

  • Transcriptional Analysis:

    • Use transcriptomics (RNA-seq or microarrays) to identify conditions that induce aaeA expression

    • Quantify expression changes using RT-qPCR or reporter gene fusions (e.g., lux)

    DNA microarray analysis has shown that after 60 minutes of exposure to 25 mM pHBA, expression of yhcQ (aaeA) in E. coli increased 22-fold .

  • Transport Assays:

    • Measure the accumulation or efflux of radiolabeled or fluorescently labeled substrates

    • Compare transport kinetics between wildtype, mutant, and overexpression strains

  • Minimum Inhibitory Concentration (MIC) Determination:

    • Assess MICs of potential substrates against wildtype and aaeA mutant strains

    • Include established efflux pump inhibitors to confirm specificity

  • Protein-Protein Interaction Studies:

    • Use bacterial two-hybrid systems, co-immunoprecipitation, or cross-linking to confirm interactions between AaeA and AaeB

    • Characterize the complete efflux complex using structural biology approaches

The most informative approach combines these methods to establish both the physiological role and the mechanistic details of AaeA function in antimicrobial resistance.

How does the structure of AaeA contribute to its function in efflux pumps?

AaeA's structure is optimized for its role in the bipartite AaeAB efflux system, which exports aromatic carboxylic acids from bacterial cells. As a membrane fusion protein (MFP), AaeA bridges the inner membrane transporter (AaeB) and potentially facilitates substrate export across the bacterial cell envelope.

Key structural features of AaeA that contribute to its function include:

  • N-terminal Transmembrane Domain: The sequence begins with "MKTLTRKLSRTAITLVLVILAFIAIFRAW," which forms a transmembrane helix anchoring AaeA in the inner membrane .

  • Periplasmic Domain: The largest portion of AaeA resides in the periplasm, where it interfaces with AaeB and potentially the outer membrane or outer membrane components.

  • Conserved Motifs: AaeA contains sequence motifs characteristic of MFP family proteins, which are essential for proper assembly of the efflux complex and substrate recognition.

These structural features allow AaeA to form a functional complex with AaeB, creating a channel for substrate export. The substrate specificity of the AaeAB system is relatively narrow compared to multidrug efflux pumps like AcrAB-TolC, focusing primarily on aromatic carboxylic acids .

What are the differences between AaeA from Salmonella agona and homologous proteins in other bacterial species?

AaeA from Salmonella agona shares significant sequence similarity with homologs in related bacterial species, but with distinct differences that may influence substrate specificity and function:

  • Comparison with E. coli AaeA: The E. coli homolog has been extensively characterized and shares high sequence identity (>90%) with Salmonella agona AaeA. Both function as components of aromatic carboxylic acid efflux systems and are regulated by similar mechanisms .

  • Sequence Variation in Salmonella Serovars: Minor sequence variations exist between AaeA proteins from different Salmonella serovars. For example, Salmonella arizonae AaeA contains a glutamine at position 74 (VNVHDNQLVQKDQ), while Salmonella agona has a lysine at the same position (VNVHDNQLVKKDQ) .

  • Functional Divergence: Despite high sequence conservation, subtle differences in the substrate-binding domains may confer different specificities for aromatic carboxylic acids among species. E. coli AaeA-AaeB shows strong activity against pHBA, salicylate, benzoate, and 1-naphthoate, but the exact substrate profile of Salmonella agona AaeA-AaeB may differ slightly .

  • Regulatory Differences: While the basic regulatory mechanism involving a LysR-type regulator is conserved, the specific induction conditions and regulatory networks may vary between species, potentially reflecting adaptation to different ecological niches.

These differences highlight the evolutionary adaptation of efflux systems to specific environmental challenges faced by different bacterial species.

How can AaeA be used as a tool for studying bacterial adaptation to environmental stresses?

AaeA can serve as a valuable marker for studying bacterial adaptation to environmental stresses, particularly those involving aromatic compounds and metabolic imbalances:

  • Reporter System Development: The aaeA promoter can be fused to reporter genes (e.g., luciferase, fluorescent proteins) to monitor cellular responses to aromatic stressors in real-time. Such reporter systems can detect environmental conditions that trigger metabolic stress responses .

  • Evolutionary Adaptation Studies:

    • Subject bacterial populations to gradual increases in aromatic compound concentrations

    • Sequence aaeA and its regulatory elements at different timepoints

    • Identify mutations that enhance efflux efficiency or alter regulation

    • This approach reveals mechanisms of bacterial adaptation to chemical stresses

  • Metabolic Pathway Analysis: AaeA expression can serve as an indicator of imbalanced aromatic compound metabolism. Researchers can use this to study how perturbations in aromatic amino acid biosynthesis or degradation pathways affect cellular homeostasis.

  • Host-Pathogen Interaction Models: Monitor aaeA expression during infection to identify host environments that trigger bacterial stress responses. This can reveal previously unknown antimicrobial mechanisms employed by hosts.

  • Biofilm Formation Studies: Investigate how aromatic compound stress and AaeA function influence biofilm formation. Research on Salmonella Agona has shown it to be a strong biofilm former, and efflux pumps often play important roles in biofilm development .

By incorporating these approaches, researchers can use AaeA as both a marker and a mechanistic component in studies of bacterial adaptation to chemical stresses.

What are the most challenging aspects of working with recombinant AaeA protein in laboratory settings?

Working with recombinant AaeA presents several technical challenges that researchers should anticipate:

  • Membrane Protein Solubility:

    • As a membrane fusion protein, AaeA contains hydrophobic regions that can cause aggregation

    • Challenge: Maintaining protein solubility during extraction and purification

    • Solution: Optimize detergent type and concentration; consider using mild non-ionic detergents like DDM or LDAO

  • Maintaining Native Conformation:

    • Challenge: Ensuring the recombinant protein adopts its native fold after purification

    • Solution: Express at lower temperatures (16-25°C); include stabilizing agents like glycerol or trehalose in buffers

  • Functional Assays:

    • Challenge: Demonstrating that purified AaeA retains its native function

    • Solution: Reconstitute with AaeB in proteoliposomes for transport assays; develop binding assays for substrate interactions

  • Protein-Protein Interactions:

    • Challenge: Studying interactions between AaeA and AaeB in vitro

    • Solution: Co-expression strategies; chemical cross-linking; pull-down assays with tagged versions

  • Crystallization Barriers:

    • Challenge: Obtaining crystal structures of membrane-associated proteins

    • Solution: Try truncated versions that retain functional domains; explore lipidic cubic phase crystallization methods

  • Expression Yield Optimization:

    • Challenge: Achieving sufficient quantities for biochemical and structural studies

    • Solution: Test multiple expression systems (bacterial, insect, mammalian); optimize codon usage; use specialized expression strains

Addressing these challenges requires systematic optimization of expression and purification protocols tailored specifically to AaeA's properties.

How has the AaeA efflux system evolved across Salmonella serovars and what does this reveal about environmental adaptation?

The evolution of the AaeA efflux system across Salmonella serovars provides insights into bacterial adaptation to different environmental niches:

These evolutionary patterns suggest that the AaeA efflux system represents an adaptation to specific environmental challenges faced by Salmonella during its evolutionary history and continues to evolve in response to new selective pressures.

What is the genomic context of aaeA in Salmonella agona and how does it compare to other efflux pump systems?

The genomic context of aaeA in Salmonella agona reveals important insights about its regulation, function, and relationship to other efflux systems:

  • Regulatory Elements:
    The aaeA gene is regulated by AaeR, a LysR-family transcriptional regulator encoded by the divergently transcribed aaeR gene. The intergenic region between aaeR and aaeX contains regulatory elements including the AaeR binding site and promoters for both the aaeR and aaeXAB transcriptional units .

  • Comparative Analysis with Other Efflux Systems:

    FeatureAaeAB SystemAcrAB-TolC SystemCusCFBA System
    ComponentsAaeA (MFP), AaeB (RND)AcrA (MFP), AcrB (RND), TolC (OMF)CusC (OMF), CusB (MFP), CusA (RND), CusF
    RegulationLysR-type (AaeR)Multiple (MarA, SoxS, Rob)Two-component (CusRS)
    Substrate RangeNarrow (aromatic carboxylic acids)Broad (antibiotics, dyes, detergents)Very narrow (Cu+, Ag+)
    Genomic ContextaaeXAB operonacrAB operon (tolC separate)cusCFBA operon
    InductionSpecific substrates (pHBA, salicylate)Multiple stressorsMetal ions
  • Chromosomal Location:
    Unlike some efflux systems that can be encoded on mobile genetic elements, the aaeA gene is chromosomally encoded in Salmonella agona. This suggests it represents a core cellular function rather than a recently acquired resistance mechanism .

  • Conservation vs. Specialization:
    The aaeA gene and its genomic context are highly conserved across Enterobacteriaceae, but with subtle variations that likely reflect specialization to different ecological niches. This contrasts with the high variability seen in plasmid-encoded efflux systems that often carry multiple resistance determinants .

The genomic context of aaeA illustrates its role as a specialized efflux system for aromatic carboxylic acids, distinct from the broader substrate range of multidrug efflux systems like AcrAB-TolC.

How does the AaeA efflux system contribute to Salmonella agona pathogenesis and persistence in hosts?

The AaeA efflux system contributes to Salmonella agona pathogenesis and persistence through several mechanisms:

  • Metabolic Homeostasis During Infection:
    The AaeA-AaeB efflux system serves as a "metabolic relief valve," helping Salmonella maintain homeostasis during infection by exporting potentially toxic aromatic compounds. This function is particularly important as bacteria face metabolic stress within host environments .

  • Persistence Mechanisms:
    Salmonella Agona has been identified as a strong biofilm former that can undergo genome rearrangement and enter a viable but non-culturable (VBNC) state while remaining metabolically active. These strategies resemble those employed by S. Typhi during the transition from acute infection to chronic carriage . Efflux systems may contribute to these persistence mechanisms.

  • Adaptation During Infection Stages:
    Research on Salmonella Agona isolates from different infection stages revealed that genomic variation increases during early, convalescent carriage (3 weeks to 3 months). This suggests population expansion after acute infection, potentially reflecting immune evasion mechanisms that enable persistent infection .

  • Host-Derived Antimicrobial Compound Resistance:
    The AaeA-AaeB system likely contributes to resistance against host-derived antimicrobial compounds with structures similar to aromatic carboxylic acids, such as bile salts and other innate immune effectors.

  • Environmental Persistence:
    Salmonella Agona's ability to persist in food-related environments is well-documented . The AaeA efflux system may contribute to survival in plant-derived food products that contain natural aromatic compounds.

Understanding the role of AaeA in pathogenesis could lead to new strategies for controlling Salmonella infections, particularly persistent infections that are difficult to eradicate with conventional antimicrobial treatments.

What techniques are most useful for studying the role of AaeA in Salmonella Agona virulence in animal models?

Several advanced techniques are particularly valuable for investigating AaeA's role in Salmonella Agona virulence using animal models:

  • Genetic Manipulation Approaches:

    • CRISPR-Cas9 gene editing to create precise aaeA deletions or point mutations

    • Complementation with wild-type or modified aaeA variants to confirm phenotypes

    • Inducible expression systems to modulate AaeA levels during specific infection stages

    • Reporter fusions (e.g., aaeA-lux) to monitor expression dynamics in vivo

  • In Vivo Imaging Technologies:

    • Bioluminescent reporters under the aaeA promoter for real-time visualization of expression

    • Two-photon microscopy to track labeled bacteria within tissues

    • Intravital microscopy to observe bacterial behavior in living tissues

  • Infection Model Selection:

    • Streptomycin-pretreated mouse model for studying intestinal colonization

    • Typhoid fever mouse model (using susceptible mouse strains) for systemic infection

    • Gallstone mouse model for studying biofilm formation and persistence

    • Chick model for age-dependent colonization studies

  • Advanced Sample Analysis:

    • Single-cell RNA sequencing to identify heterogeneous bacterial populations

    • Metabolomics to profile aromatic compounds in infected tissues

    • Dual RNA-seq to simultaneously analyze host and pathogen transcriptomes

    • Spatial transcriptomics to map expression patterns within infected tissues

  • Competitive Index Assays:

    • Co-infection with wild-type and aaeA mutant strains

    • Calculation of competitive indices at different infection timepoints

    • Recovery of bacteria from different anatomical sites to assess tissue-specific roles

  • Long-term Persistence Models:

    • Extended infection timelines (weeks to months) to study chronic carriage

    • Periodic sampling to track genomic changes during persistence

    • Analysis of bacterial population diversity using deep sequencing

These techniques, used in combination, can provide comprehensive insights into the role of AaeA in Salmonella Agona pathogenesis, from initial colonization through acute infection and into persistent carriage states.

What are the best approaches for resolving contradictory results in AaeA functional studies?

When faced with contradictory results in AaeA functional studies, researchers should implement a systematic troubleshooting and validation strategy:

  • Strain and Construct Verification:

    • Confirm the genetic background of bacterial strains used

    • Sequence-verify all constructs to ensure no unexpected mutations

    • Test multiple independent clones to rule out clone-specific effects

    • Use appropriate positive and negative controls in all experiments

  • Experimental Condition Standardization:

    • Systematically vary growth conditions (media, temperature, pH, aeration)

    • Standardize growth phase for all experiments (early/mid/late log phase)

    • Document all experimental variables that could affect results

    • Develop standard operating procedures for key assays

  • Methodological Diversity:

    • Apply multiple complementary techniques to address the same question

    • For gene expression studies, combine transcriptomics, RT-qPCR, and reporter assays

    • For protein function, combine genetic approaches with biochemical assays

    • Use both in vitro and in vivo systems when possible

  • Statistical Rigor:

    • Ensure adequate biological and technical replicates

    • Apply appropriate statistical tests for data analysis

    • Consider effect sizes, not just statistical significance

    • Perform power analyses to determine required sample sizes

  • Collaborative Validation:

    • Engage independent laboratories to replicate key findings

    • Share materials and detailed protocols to ensure reproducibility

    • Consider blind testing of samples to eliminate unconscious bias

  • Systems Biology Approaches:

    • Integrate data from multiple levels (genomic, transcriptomic, proteomic, metabolomic)

    • Apply computational modeling to reconcile seemingly contradictory results

    • Consider potential regulatory networks and feedback mechanisms

By systematically applying these approaches, researchers can resolve contradictions and develop a more complete understanding of AaeA function in different experimental contexts.

How can researchers effectively isolate and study AaeA-AaeB interactions in membrane systems?

Studying protein-protein interactions between membrane components like AaeA and AaeB presents unique challenges that require specialized approaches:

  • Co-Expression Systems:

    • Design constructs for simultaneous expression of AaeA and AaeB

    • Use dual-tagging strategies (e.g., His-tag on AaeA, Strep-tag on AaeB)

    • Express in E. coli membrane-protein-optimized strains (e.g., C41/C43)

    • Utilize inducible promoters with tunable expression levels

  • Membrane Preparation Techniques:

    • Isolate total membranes using ultracentrifugation

    • Separate inner and outer membranes using sucrose density gradients

    • Extract membrane proteins using mild detergents (DDM, LMNG, or amphipols)

    • Reconstitute into nanodiscs or liposomes to maintain native environment

  • Interaction Detection Methods:

    • Chemical Cross-linking: Use membrane-permeable crosslinkers followed by mass spectrometry

    • Co-purification: Tandem affinity purification to isolate intact complexes

    • Resonance Energy Transfer: FRET or BRET between fluorescently labeled components

    • Surface Plasmon Resonance: For measuring binding kinetics and affinities

  • Functional Reconstitution:

    • Reconstitute purified AaeA and AaeB into proteoliposomes

    • Develop substrate transport assays using fluorescent or radioactive pHBA

    • Compare activity of individual proteins vs. the reconstituted complex

    • Assess the impact of lipid composition on complex formation and function

  • Structural Biology Approaches:

    • Cryo-electron microscopy of membrane protein complexes

    • X-ray crystallography of stabilized complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Solid-state NMR for studying membrane-embedded complexes

  • Computational Methods:

    • Molecular dynamics simulations of AaeA-AaeB interactions in membranes

    • Protein-protein docking to predict interaction interfaces

    • Coevolution analysis to identify potentially interacting residues

    • Integration of experimental constraints with computational models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.