Recombinant Salmonella agona Phosphoglycerol transferase I (mdoB)

What is Phosphoglycerol transferase I (mdoB) and what is its functional role in bacterial membranes?

Phosphoglycerol transferase I (mdoB) is a membrane-bound enzyme that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs). In Salmonella agona, as in other gram-negative bacteria, this enzyme plays a critical role in membrane biogenesis and periplasmic osmoregulation. The enzyme is characterized as an integral membrane protein with its active site facing the periplasmic space, allowing it to modify surface oligosaccharides with phosphoglycerol residues .

The reaction catalyzed by mdoB can be represented as:

Phosphatidylglycerol + Membrane-derived oligosaccharide → Phosphoglycerol-substituted MDO + sn-1,2-diglyceride

This transfer reaction is significant for bacterial envelope integrity and has been implicated in adaptation to environmental osmotic changes. The genetic locus for mdoB maps near minute 99 on the bacterial chromosome, and mutations in this gene result in the production of MDOs lacking phosphoglycerol residues .

What is the structural composition of recombinant S. agona Phosphoglycerol transferase I?

Recombinant Salmonella agona Phosphoglycerol transferase I is a full-length transmembrane protein consisting of 763 amino acids. The protein sequence begins with "MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV..." and contains multiple transmembrane domains that anchor it within the cytoplasmic membrane . The protein has several functional domains including:

• N-terminal transmembrane region

• Catalytic domain that facilitates phosphoglycerol transfer

• Substrate binding sites for both phosphatidylglycerol and membrane oligosaccharides

• C-terminal region involved in proper folding and stability

When expressed recombinantly, the protein is typically produced with an N-terminal 10xHis-tag to facilitate purification while maintaining enzymatic function . The molecular structure reveals several conserved regions that are critical for its phosphotransferase activity.

How should researchers optimally store and handle recombinant mdoB preparations?

For optimal stability and activity retention of recombinant Salmonella agona Phosphoglycerol transferase I, researchers should follow these evidence-based storage protocols:

Researchers should note several critical handling considerations:

• Avoid repeated freeze-thaw cycles as these significantly diminish enzyme activity

• Prepare working aliquots upon initial thawing to minimize protein degradation

• Store in buffer systems containing stabilizing agents (glycerol, reducing agents)

• Maintain sterile conditions during handling to prevent microbial contamination

For experiments requiring extended storage periods, lyophilization is recommended, extending shelf life to approximately 12 months when stored at -20°C or -80°C . Always validate enzyme activity after prolonged storage before conducting critical experiments.

What expression systems are most effective for producing functional recombinant mdoB?

The most effective expression system for producing functional recombinant Salmonella agona Phosphoglycerol transferase I is E. coli-based in vitro expression. This approach offers several advantages when optimized with the following parameters:

• Expression vector selection: Vectors containing strong inducible promoters (T7, tac) with appropriate fusion tags (particularly N-terminal His-tags) yield highest recovery of functional protein

• Host strain optimization: E. coli strains engineered for membrane protein expression (such as C41(DE3) or C43(DE3)) significantly improve yield of correctly folded mdoB

• Induction conditions: Low-temperature induction (16-18°C) with reduced inducer concentration extends expression time and improves proper protein folding

• Membrane fraction recovery: Careful isolation of membrane fractions using optimized lysis and centrifugation protocols is essential for preserving native conformation

The recombinant protein produced through these systems should be verified for proper folding and function through activity assays measuring phosphoglycerol transfer to appropriate substrates such as arbutin, which serves as a model substrate for activity verification .

How can researchers design experiments to investigate substrate specificity of mdoB?

Designing experiments to investigate substrate specificity of Phosphoglycerol transferase I requires a systematic approach using both natural and synthetic substrates. The following experimental framework addresses this complex question:

Step 1: Substrate Panel Assembly

Construct a diverse substrate panel including:

• Natural phosphatidylglycerol variants with different fatty acid compositions

• Synthetic membrane-derived oligosaccharide analogues

• Model substrates like arbutin (p-hydroxyphenyl-β-D-glucoside), which has been validated as an effective model substrate

Step 2: Kinetic Analysis Design

Implement a Design of Experiments (DoE) approach to efficiently investigate multiple parameters simultaneously:

• Vary substrate concentrations systematically across a physiologically relevant range

• Test various reaction conditions (pH, temperature, ionic strength)

• Include appropriate controls for non-enzymatic reactions

Step 3: Activity Detection Methods

• Direct measurement of phosphoglycerol transfer using radiolabeled substrates

• Quantification of reaction products (particularly sn-1,2-diglyceride formation)

• Monitoring substrate depletion rates using chromatographic methods

Step 4: Data Analysis Framework

Apply statistical models to:

• Generate Michaelis-Menten parameters for different substrates

• Calculate relative specificity constants (kcat/KM)

• Develop structure-activity relationships

This comprehensive experimental design enables researchers to elucidate substrate preferences and biochemical constraints of mdoB enzyme activity while minimizing experimental variability through systematic testing approaches.

What genetic approaches can be used to study mdoB function in vivo?

To study mdoB function in vivo, researchers can employ several genetic approaches that provide comprehensive insights into the physiological roles of Phosphoglycerol transferase I:

Targeted Gene Disruption Strategy

The most definitive approach leverages the arbutin resistance phenotype as demonstrated in previous studies. When strains bearing the dgk mutation (defective in diglyceride kinase) are grown in media containing arbutin, they accumulate sn-1,2-diglyceride due to phosphoglycerol transferase I activity, resulting in growth inhibition. A secondary mutation in mdoB confers arbutin resistance by preventing this accumulation .

Experimental protocol:

• Create dgk mutant strains using site-directed mutagenesis or transposon insertion

• Culture cells on arbutin-containing media to select for spontaneous mdoB mutants

• Confirm genotype through PCR and sequencing of the mdoB locus

• Validate phenotype by assessing membrane-derived oligosaccharide composition

Complementation Analysis

For confirming gene function and structure-function relationships:

• Construct expression vectors containing wild-type or mutated mdoB genes

• Transform these constructs into mdoB-deficient strains

• Assess restoration of phosphoglycerol transfer activity and related phenotypes

• Analyze membrane-derived oligosaccharides for phosphoglycerol content

This genetic approach has provided strong evidence for the in vivo function of phosphoglycerol transferase I in membrane-derived oligosaccharide biosynthesis and offers a platform for further investigation of protein domains and catalytic mechanisms .

How can metabolic atom mapping approaches be applied to study mdoB-catalyzed reactions?

Metabolic atom mapping provides powerful insights into the mechanistic details of mdoB-catalyzed phosphoglycerol transfer reactions by tracing the movement of individual atoms from substrates to products. This advanced approach reveals reaction mechanisms at atomic resolution:

Implementation Strategy for mdoB Reaction Mapping

• Database Integration and Model Construction:

  • Incorporate mdoB reactions into metabolic atom mapping databases like MetAMDB

  • Ensure proper metabolite structure representation through MOL files with standardized atom numbering according to InChI conventions

  • Validate carbon balance (substrate carbon atoms must equal product carbon atoms) to ensure reaction completeness

• Reaction Mechanism Analysis:

  • Track specific phosphoglycerol atoms from phosphatidylglycerol to membrane-derived oligosaccharides

  • Map the formation of sn-1,2-diglyceride byproducts to understand bond cleavage patterns

  • Identify potential reaction intermediates through transition state modeling

• Isotopic Labeling Experimental Design:

  • Design isotope labeling experiments with 13C-labeled substrates

  • Predict isotopic enrichment patterns using computational models

  • Compare experimental and predicted patterns to validate mechanistic hypotheses

• Integration with Flux Analysis:

  • Incorporate atom mapping data into metabolic flux models

  • Simulate isotopic enrichment patterns under various conditions

  • Use these models to predict the effects of genetic or environmental perturbations

This comprehensive approach bridges computational and experimental methodologies, providing researchers with mechanistic understanding of phosphoglycerol transfer at atomic resolution while revealing the broader metabolic context of mdoB function.

What analytical methods are most reliable for quantifying mdoB enzymatic activity?

Accurate quantification of Phosphoglycerol transferase I activity requires carefully selected analytical methods tailored to the unique characteristics of this membrane-associated enzyme. The following methodological approaches provide complementary data for comprehensive activity assessment:

Primary Assay Methods

• Radiometric Assay

  • Substrate: [14C]-labeled phosphatidylglycerol

  • Detection: Quantification of radiolabeled phosphoglycerol transfer to acceptor molecules

  • Sensitivity: Capable of detecting femtomole-level activity

  • Advantages: High specificity and excellent signal-to-noise ratio

• Arbutin-Based Spectrophotometric Assay

  • Principle: Monitoring of phosphoglycerol-arbutin conjugate formation

  • Detection: Spectrophotometric measurement at 280nm

  • Throughput: Suitable for microplate format and high-throughput screening

  • Applications: Ideal for initial activity screening and inhibitor studies

• HPLC-Mass Spectrometry

  • Approach: Direct quantification of reaction products

  • Markers: Detection of sn-1,2-diglyceride formation and phosphoglycerol-MDO conjugates

  • Advantage: Provides structural confirmation of products alongside quantitative data

Activity Validation Metrics

The table below outlines critical quality control parameters for mdoB activity assays:

When analyzing complex biological samples, researchers should implement appropriate controls to account for potential interfering activities and ensure specificity for mdoB-catalyzed reactions.

How do mutations in mdoB affect bacterial membrane integrity and function?

Mutations in the mdoB gene have profound implications for bacterial membrane composition and function, affecting multiple aspects of bacterial physiology:

Membrane Composition Alterations

Studies demonstrate that mdoB mutants produce membrane-derived oligosaccharides entirely devoid of phosphoglycerol substituents . This chemical alteration results in:

• Modified surface charge distribution across the periplasmic face of the inner membrane

• Altered interactions with divalent cations that normally bridge between negatively charged groups

• Compromised structural integrity of the membrane-periplasm interface

Functional Consequences

These structural changes translate to several functional impacts:

• Osmotic Stress Response

  • mdoB mutants show increased sensitivity to hypoosmotic shock

  • Periplasmic solute balance is disrupted under fluctuating environmental conditions

  • Recovery from osmotic challenge occurs more slowly than in wild-type strains

• Membrane Permeability

  • Subtle increases in membrane permeability to small hydrophilic molecules

  • Altered antibiotic susceptibility profiles, particularly for compounds targeting cell envelope

  • Modified outer membrane protein distribution and assembly

• Signaling and Adaptation

  • Activation of envelope stress response pathways

  • Compensatory changes in other membrane components

  • Altered expression of genes involved in envelope maintenance

These findings highlight the critical role of phosphoglycerol transferase I in maintaining proper bacterial membrane function through its specific modification of membrane-derived oligosaccharides, with implications for bacterial adaptation to environmental challenges and potential antimicrobial development strategies.

What are the key considerations for designing a phosphoglycerol transferase I inhibition assay?

Designing robust inhibition assays for Phosphoglycerol transferase I requires careful consideration of enzyme characteristics, substrate properties, and detection methodologies. The following framework outlines a comprehensive approach:

Assay Design Parameters

• Enzyme Preparation

  • Use highly purified recombinant mdoB (>95% purity)

  • Ensure proper folding and membrane integration using suitable detergents

  • Validate activity before inhibition studies

  • Consider using N-terminal 10xHis-tagged protein for consistent preparation

• Substrate Selection and Optimization

  • Primary natural substrate: Phosphatidylglycerol

  • Model substrate: Arbutin (p-hydroxyphenyl-β-D-glucoside)

  • Determine Km values for all substrates

  • Set substrate concentrations at or near Km for inhibition studies

• Reaction Conditions Optimization
  Using Design of Experiments (DoE) methodology :

  • Systematically test pH range (6.5-8.0)

  • Optimize buffer composition (ionic strength, stabilizing agents)

  • Determine ideal temperature and incubation times

  • Evaluate effects of potential cofactors and divalent cations

• Inhibitor Handling

  • Prepare stock solutions in appropriate solvents

  • Verify inhibitor solubility under assay conditions

  • Include vehicle controls (matching solvent concentrations)

  • Test for potential interference with detection methods

• Data Analysis Framework

  • Generate IC50 curves with appropriate statistical models

  • Determine inhibition mechanisms (competitive, non-competitive, etc.)

  • Calculate Ki values for promising inhibitors

  • Validate with orthogonal assay methods

This systematic approach enables researchers to develop reliable inhibition assays that can be used for mechanistic studies and potential inhibitor discovery, with applications in fundamental research and possible antimicrobial development.

This methodical framework incorporates Design of Experiments principles to efficiently optimize multiple parameters simultaneously while minimizing experimental variability and resource utilization .