Recombinant Salmonella agona Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

The arnE gene encodes a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, a critical component of lipid A modification in Salmonella enterica serovar Agona. This enzyme facilitates the transport of undecaprenyl phosphate-α-L-Ara4N (L-Ara4N) across the inner membrane, enabling its incorporation into lipid A, the toxic core of lipopolysaccharide (LPS) . This modification enhances resistance to cationic antimicrobials, such as polymyxins, by reducing the negative charge of lipid A, thereby preventing drug binding .

Key Properties of ArnE

PropertyDescriptionSource
UniProt IDA6V1N7 (Pseudomonas aeruginosa PA7 reference)
RefSeq AccessionWP_012074755.1
FunctionFlippase subunit for L-Ara4N-phosphoundecaprenol transport
Expression SystemRecombinant protein expressed in E. coli with N-terminal His-tag
Role in ResistanceIntegral to polymyxin resistance via lipid A modification

Role in Antimicrobial Resistance

ArnE is central to polymyxin resistance in S. Agona, a serovar increasingly linked to multidrug-resistant (MDR) isolates .

Resistance Mechanisms

  • Lipid A Modification: Reduces LPS’s affinity for polymyxins (e.g., colistin), critical in nosocomial infections .

  • Plasmid-Mediated Spread: MDR S. Agona isolates often harbor IncHI2 plasmids carrying 12–23 antibiotic resistance genes (ARGs), including fosA7.2 and qnrB19 .

Prevalence in S. Agona

Resistance FeatureS. Agona Isolates (Key Findings)Source
Primary ARGfosA7.2 (fosfomycin resistance)
Plasmid TypesIncHI2 plasmids (e.g., pSE18-SA00377-1) with ARG clusters
Heavy Metal ResistanceGenes for Cd²⁺, Cu²⁺, Hg²⁺, Ni²⁺, Pb²⁺, Zn²⁺ resistance

Research Applications and Recombinant Production

ArnE is utilized in structural biology and antimicrobial resistance studies. Recombinant ArnE is produced for:

  • Enzymatic Assays: Studying flippase activity and substrate specificity .

  • Drug Development: Targeting lipid A modification to restore polymyxin efficacy .

Key Findings

  • Clonal Dissemination: S. Agona isolates from Latin America share fosA7.2, suggesting horizontal gene transfer .

  • Genomic Stability: Most arnE sequences show minimal variation, indicating functional conservation .

  • Environmental Persistence: S. Agona biofilm-forming capacity correlates with surface water contamination .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; SeAg_B2438; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
arnE
Target Protein Sequence
MIGVVLVLASLLSVGGQLCQKQATRPLTAGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
This protein functions as a translocator that moves 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the known function of ArnE in Salmonella species?

ArnE functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, which plays a critical role in lipopolysaccharide modification and antimicrobial resistance. This protein is part of the system that transfers the 4-amino-4-deoxy-L-arabinose moiety across the cytoplasmic membrane, enabling modifications to lipid A that reduce binding affinity of cationic antimicrobial peptides and antibiotics. While direct experimental data for Salmonella agona ArnE is limited, computational structure models suggest significant structural conservation with homologs like those found in Escherichia coli O139:H28 str. E24377A . The protein's integration within membrane systems makes it challenging to study but crucial for understanding mechanisms of antibiotic resistance. Recent genomic analyses of Salmonella isolates suggest ArnE may contribute to the multidrug resistance observed in clinical and environmental isolates.

How conserved is the arnE gene across different Salmonella enterica serovars?

The arnE gene shows notable conservation across Salmonella enterica serovars, including Salmonella Agona, which has been implicated in several significant outbreaks . Comparative genomics studies of multidrug-resistant Salmonella isolates reveal that the arnE gene is part of the core genome components that maintain relatively high sequence identity. Genomic characterization studies of Salmonella isolates with antimicrobial resistance profiles show that arnE is frequently present alongside other resistance determinants. Particularly in plasmid-rich isolates like the multidrug-resistant S. enterica isolate analyzed in recent research, arnE contributes to a broader resistance phenotype involving multiple antibiotic classes . Phylogenetic analyses suggest the gene likely predates the diversification of Salmonella serovars and has been maintained due to selective pressure from environmental antimicrobials. When comparing arnE sequences between serovars like Agona and Paratyphi A, researchers typically observe >90% amino acid sequence identity, reflecting its functional importance in membrane processes.

How does ArnE contribute to specific antimicrobial resistance mechanisms in Salmonella agona?

ArnE plays a crucial role in antimicrobial resistance through its function in modifying the bacterial outer membrane. As a component of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, ArnE facilitates the transport of modified arabinose across the cytoplasmic membrane, ultimately allowing for the addition of this moiety to lipid A. This modification reduces the net negative charge of lipopolysaccharide, decreasing binding affinity for positively charged antimicrobial peptides and certain antibiotics. Recent genomic analysis of multidrug-resistant Salmonella enterica isolates has shown that arnE often co-occurs with other resistance determinants on large plasmids, contributing to resistance against multiple antibiotic classes . In the characterized multidrug-resistant Salmonella isolate carrying 23 different antibiotic resistance genes, the arnE gene was found to be particularly associated with resistance to polymyxins and other cationic antimicrobial peptides. The gene's expression is typically induced by environmental signals including low Mg2+ and pH, conditions that bacteria encounter during host infection.

What are the structural determinants of ArnE that distinguish it from homologs in other enteric bacteria?

Structural analysis of ArnE reveals several distinctive features compared to homologs in other enteric bacteria. Computational structure predictions, such as those available for the E. coli homolog through AlphaFold, indicate a multi-pass membrane protein with several transmembrane helices . The E. coli ArnE model shows a global pLDDT (predicted local distance difference test) score of 88.62, suggesting a high-confidence prediction for most structural regions . Comparing Salmonella ArnE with E. coli homologs reveals conservation in core transmembrane domains but notable differences in certain loop regions and potential interaction surfaces. These structural distinctions may account for species-specific differences in substrate specificity or protein-protein interactions within the flippase complex. The predicted structure exhibits several charged amino acids at the cytoplasmic interface that likely participate in substrate recognition. Specific residues within transmembrane helices 2 and 4 appear to form a substrate translocation pathway, with variations in these regions potentially underlying functional differences between bacterial species. Conservation analysis across multiple sequence alignments suggests that residues facing the lipid bilayer are more variable than those lining the putative substrate channel.

How does ArnE interact with other components of the LPS modification pathway?

ArnE functions within a complex network of proteins involved in lipopolysaccharide modification. As one subunit of the flippase complex, ArnE works in conjunction with ArnF to form a functional heterodimer that facilitates substrate translocation across the membrane. Biochemical analyses suggest that ArnE interacts directly with the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol substrate produced by upstream enzymes in the pathway (ArnA, ArnB, ArnC). Protein-protein interaction studies utilizing techniques such as bacterial two-hybrid systems and co-immunoprecipitation have identified specific regions of ArnE that mediate contacts with ArnF and potentially other pathway components. The complete pathway includes cytoplasmic synthesis of the modified arabinose (by ArnA/B/C/D), flipping across the membrane (by ArnE/F), and final transfer to lipid A (by ArnT). Disruption of ArnE function impairs this pathway, resulting in increased sensitivity to polymyxins and other cationic antimicrobial compounds. Recent structural studies of related membrane transporters suggest that conformational changes in the ArnE/F complex likely drive substrate translocation through an alternating access mechanism.

What are the optimal conditions for purifying functional recombinant ArnE protein?

Purification of functional recombinant ArnE requires carefully optimized protocols to maintain protein stability and activity. After expression, bacterial cells should be disrupted by pressure-based lysis rather than sonication to minimize protein denaturation. Membrane fraction isolation via ultracentrifugation (typically 100,000×g for 1 hour) provides enrichment before detergent solubilization. Critical parameters for successful purification include: (1) detergent selection, with n-dodecyl-β-D-maltoside (DDM) at 1-1.5% showing best results for initial solubilization, followed by reduction to 0.05% in subsequent buffers; (2) buffer composition, typically incorporating 20-50 mM Tris-HCl pH 7.5, 150-300 mM NaCl, 5% glycerol, and 1 mM DTT; (3) purification strategy, usually involving immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography; and (4) temperature control, maintaining samples at 4°C throughout all steps. Protein yield and stability can be assessed through standard techniques like SDS-PAGE, Western blotting, and thermal shift assays. Functional integrity should be verified through reconstitution into proteoliposomes and substrate transport assays, typically using fluorescently labeled substrate analogs. Most successful protocols report final yields of 0.5-2 mg of purified ArnE protein per liter of bacterial culture.

What experimental approaches can determine ArnE substrate specificity?

Determining ArnE substrate specificity requires multiple complementary approaches due to the challenges of working with membrane transport proteins. Liposome-based transport assays represent the gold standard, wherein purified ArnE (often co-reconstituted with ArnF) is incorporated into artificial membrane vesicles followed by assessment of substrate translocation. Researchers typically prepare fluorescently labeled substrate analogs of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol, measuring transport through changes in fluorescence signal over time. Comparative transport kinetics with substrate variants can reveal structural determinants of specificity. Alternative approaches include binding assays using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) with detergent-solubilized protein, though these methods assess binding rather than transport. In vivo approaches utilizing genetic complementation in arnE-deleted bacterial strains can assess the ability of mutant proteins to restore antimicrobial resistance, providing functional information in a cellular context. Competition assays with putative alternative substrates can reveal relative affinities and transport preferences. Molecular dynamics simulations based on structural models offer complementary insights into substrate interactions and potential translocation pathways.

How can site-directed mutagenesis be applied to probe ArnE function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in ArnE. Based on sequence conservation analysis and structural predictions, researchers should prioritize highly conserved residues within transmembrane domains, particularly those facing the putative translocation pathway. A systematic mutagenesis strategy typically begins with alanine scanning of conserved charged or polar residues, followed by more subtle substitutions to probe specific chemical properties. Key targets include charged residues at membrane interfaces (potentially involved in substrate recognition) and conserved residues in transmembrane helices (likely forming the translocation pathway). For membrane proteins like ArnE, mutagenesis should incorporate proper controls for expression and membrane localization before interpreting functional effects. This typically involves Western blotting of membrane fractions and fluorescent tagging to verify proper localization. Functional assays for mutant proteins should include both in vitro reconstitution approaches and in vivo complementation tests measuring antimicrobial resistance restoration. Properly designed mutagenesis studies can reveal residues essential for substrate binding versus those involved in conformational changes or protein-protein interactions within the flippase complex.

How might ArnE be targeted for development of novel antimicrobial agents?

ArnE represents a promising target for antimicrobial development due to its essential role in resistance mechanisms. Inhibiting ArnE function would potentially re-sensitize resistant bacteria to existing antibiotics, particularly polymyxins and other cationic antimicrobial peptides. Structure-based drug design approaches, utilizing computational models like those available for E. coli ArnE homologs, can identify potential binding pockets for small molecule inhibitors . Virtual screening campaigns targeting these sites, followed by experimental validation, represent a primary approach to inhibitor discovery. Alternative strategies include developing peptidomimetics that interfere with ArnE-substrate interactions or ArnE-ArnF protein partnerships. High-throughput screening approaches using bacterial strains with reporter systems linked to outer membrane integrity can identify compounds that potentially target the ArnE pathway. Fragment-based drug discovery methods, particularly those utilizing NMR for detecting weak binding interactions, may prove valuable for identifying chemical starting points for inhibitor development. The development of ArnE inhibitors would likely be most valuable as adjuvants to restore effectiveness of existing antibiotics rather than as standalone antimicrobials.

What is the relationship between ArnE expression and virulence in Salmonella agona?

The relationship between ArnE expression and Salmonella agona virulence represents an important but understudied area. ArnE-mediated lipopolysaccharide modifications affect not only antimicrobial resistance but also interactions with host immune systems. Lipid A modifications facilitated by the Arn pathway can alter recognition by Toll-like receptor 4 (TLR4), potentially affecting inflammatory responses during infection. Several studies of Salmonella outbreaks have documented the persistence of specific strains over time, suggesting stable adaptations that balance virulence and survival . The notable 10-year persistence between the 1998 and 2008 Salmonella Agona outbreaks linked to the same production facility demonstrates how certain strains can maintain long-term stability . Transcriptional analyses show that arnE expression is regulated by the PhoPQ and PmrAB two-component systems, which respond to environmental signals encountered during infection. Animal infection models comparing wild-type Salmonella with arnE mutants typically show reduced bacterial loads in tissues and decreased inflammation with the mutant strains. This suggests ArnE-mediated LPS modifications contribute to virulence through multiple mechanisms, including enhanced resistance to host antimicrobial peptides and altered immune detection.

How do horizontally transferred plasmids affect ArnE function in multidrug-resistant Salmonella strains?

Horizontally transferred plasmids significantly impact the antimicrobial resistance landscape in Salmonella, including potential effects on ArnE function. Recent genomic characterization of multidrug-resistant Salmonella enterica isolates has revealed large plasmids carrying numerous resistance determinants . The analysis of a particularly concerning isolate identified a 295,499 bp IncHI2 family plasmid carrying 16 antibiotic resistance genes organized in distinct clusters . While the chromosomal arnE gene provides baseline LPS modification capability, plasmid-borne genes may encode additional enzymes that work in concert with ArnE or provide alternative modification pathways. Transcriptomic studies comparing strains before and after plasmid acquisition demonstrate complex regulatory adjustments affecting chromosomal gene expression, potentially including arnE. Plasmid-encoded transcriptional regulators can alter expression patterns of chromosomal genes, creating integrated resistance networks. Structural variations in ArnE between different Salmonella isolates, combined with plasmid-encoded factors, likely contribute to the variable resistance profiles observed across clinical isolates. The spread of these plasmids across different bacterial genera, as documented in recent studies, increases the concern about resistance dissemination and highlights the importance of monitoring ArnE variants and associated genes in surveillance programs .

What analytical techniques provide the most reliable structural information for ArnE protein?

Multiple analytical techniques offer complementary insights into ArnE structure, each with distinct advantages. X-ray crystallography remains challenging for membrane proteins like ArnE but provides the highest resolution when successful, requiring detergent-solubilized protein crystallization or lipidic cubic phase approaches. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly for membrane protein complexes, with recent advances allowing near-atomic resolution without crystallization. NMR spectroscopy can provide valuable dynamics information but is typically limited to specific domains or segments of ArnE due to size constraints. Computational structure prediction, as exemplified by AlphaFold models for E. coli ArnE homologs, offers increasingly reliable structural hypotheses with confidence metrics like pLDDT scores (reported as 88.62 for the E. coli homolog) . The reliability of these methods can be compared through the following assessment table:

TechniqueResolution RangeSample RequirementsAdvantagesLimitationsApplication to ArnE
X-ray Crystallography1.5-3.5ÅPurified protein crystalsHighest potential resolutionDifficult crystallizationLimited success to date
Cryo-EM2.5-4.5ÅPurified protein (≥150 kDa preferred)No crystallization neededSize limitationsPromising for ArnE/F complex
NMR SpectroscopyN/A (atomic)Isotope-labeled purified proteinDynamic informationSize limitationsSuitable for specific domains
Computational PredictionN/ASequence dataNo experimental sample neededRequires validationAvailable models with high confidence scores
Hydrogen-Deuterium Exchange MSN/APurified proteinProbes solvent accessibilityLow resolutionComplements other techniques

For ArnE research, an integrated approach combining computational models with experimental validation through techniques like hydrogen-deuterium exchange mass spectrometry offers the most practical strategy given current technological limitations.

How do in vitro and in vivo systems compare for studying ArnE function?

Researchers must carefully consider the complementary strengths and limitations of in vitro and in vivo systems when investigating ArnE function. In vitro approaches using purified components offer precise control and mechanistic insights but may not fully recapitulate the complex cellular environment. In vivo methods preserve native context but present challenges in isolating ArnE-specific effects from other cellular processes. The following table summarizes key comparative aspects:

ParameterIn Vitro SystemsIn Vivo Systems
Component ControlHigh (defined components)Low (cellular complexity)
Physiological RelevanceLimited (artificial environment)High (natural context)
ThroughputGenerally higherGenerally lower
Mechanistic DetailDirect measurement possibleOften inferential
Technical ComplexityVariable (system-dependent)Moderate to high
Typical ApproachesProteoliposome transport assays, binding studiesGene knockouts, complementation, resistance assays
Strengths for ArnE ResearchDirect measurement of transport activity, biochemical parameter determinationAssessment of biological significance, integration with other pathways
Limitations for ArnE ResearchMay not reflect native membrane environmentDifficult to distinguish direct from indirect effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.