Recombinant Salmonella agona Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella agona Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Salmonella agona Probable ubiquinone biosynthesis protein UbiB (ubiB) is a protein derived from the bacterium Salmonella agona, specifically involved in the biosynthesis of ubiquinone, also known as coenzyme Q (CoQ). CoQ is a crucial component in the electron transport chain of bacteria, playing a vital role in energy production and maintaining cellular redox balance. The UbiB protein is part of a larger family of proteins involved in CoQ biosynthesis across various organisms.

Function and Role of UbiB in CoQ Biosynthesis

UbiB is essential for the first monooxygenase step in CoQ biosynthesis, a process that involves the conversion of octaprenylphenol into CoQ. This step is critical for the assembly of the respiratory chain and energy production in bacteria. While UbiB is primarily recognized for its role in CoQ biosynthesis, it is also part of a predicted protein kinase family, suggesting potential regulatory functions in this biosynthetic pathway .

Characteristics of Recombinant Salmonella agona UbiB

The recombinant UbiB protein from Salmonella agona is produced through genetic engineering techniques, allowing for its expression and purification for research purposes. This protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability and is recommended to be stored at -20°C for long-term preservation .

Research Findings and Applications

Research on UbiB and its role in CoQ biosynthesis has implications for understanding bacterial metabolism and energy production. Studies on UbiB homologs in other bacteria, such as Escherichia coli, have shown that mutations in the ubiB gene can lead to defects in CoQ biosynthesis, resulting in the accumulation of intermediates like octaprenylphenol .

Data Table: Key Features of UbiB in Different Bacteria

FeatureSalmonella agonaEscherichia coli
FunctionCoQ biosynthesisCoQ biosynthesis
RoleMonooxygenase stepMonooxygenase step
Protein FamilyPredicted protein kinasePredicted protein kinase
Storage ConditionsTris-based buffer, 50% glycerolNot specified

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; SeAg_B4203; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of UbiB in ubiquinone biosynthesis in Salmonella agona?

UbiB is a probable ubiquinone biosynthesis protein that likely plays a critical role in the O₂-dependent pathway of ubiquinone production. Based on studies in related proteobacteria, UbiB functions as part of a complex machinery that enables S. agona to synthesize ubiquinone, an essential component of the electron transport chain. Ubiquinone biosynthesis pathways in proteobacteria have been found to operate across the entire O₂ range, with specialized proteins functioning under different oxygen conditions . This adaptability allows bacteria like S. agona to optimize their metabolism across varying environmental conditions, which may contribute to their persistence in food production environments and virulence during infection .

Methodologically, researchers investigating UbiB function should consider comparative studies with the recently characterized O₂-independent pathway proteins (UbiT, UbiU, and UbiV) to understand the full spectrum of ubiquinone biosynthesis capabilities in S. agona .

How is UbiB genetically conserved across Salmonella species compared to other proteobacteria?

The ubiB gene shows considerable conservation across Salmonella species, though the specific genetic context may vary. Comparative genomic analyses indicate that while the core function is preserved, there can be notable variations in regulatory elements and neighboring genes that may influence expression patterns. When studying UbiB conservation, researchers should:

  • Perform phylogenetic analyses of ubiB sequences across multiple bacterial species

  • Analyze the genomic context surrounding ubiB to identify syntenic relationships

  • Examine single nucleotide polymorphisms (SNPs) that might affect protein function

A minimum SNP distance analysis, similar to that performed for S. agona isolates in other contexts, can reveal evolutionary relationships between strains with different ubiB variants . This approach can identify closely related isolates and potentially link specific genetic variants to phenotypic differences in ubiquinone biosynthesis efficiency.

What techniques are available for detecting and quantifying UbiB expression in Salmonella agona?

Several complementary techniques can be employed for robust detection and quantification of UbiB expression:

TechniqueApplicationAdvantagesLimitations
RT-qPCRmRNA quantificationHigh sensitivity, good for low-abundance transcriptsPost-transcriptional regulation not captured
Western blotProtein detectionDirect protein quantification, can detect modificationsRequires specific antibodies, semi-quantitative
Mass spectrometryProtein identificationAbsolute quantification possible, detects modificationsComplex sample preparation, expensive
Reporter fusionsIn vivo expressionReal-time monitoring, single-cell resolutionMay alter native regulation
RNA-SeqTranscriptome analysisGenome-wide context, detects novel transcriptsComplex data analysis, costly

When designing experiments to measure UbiB expression, researchers should consider the environmental conditions relevant to S. agona ecology, particularly oxygen availability, as this likely influences ubiquinone biosynthesis pathway regulation . Additionally, experimental designs should include appropriate controls and randomization to minimize bias and ensure reproducibility .

How should researchers design experiments to study UbiB function in Salmonella agona?

Designing robust experiments to study UbiB function requires careful consideration of multiple factors:

  • Define clear hypotheses: Begin with specific, testable hypotheses about UbiB function rather than general exploratory experiments . For example, "UbiB is essential for S. agona growth under aerobic but not anaerobic conditions."

  • Select appropriate controls: Include wild-type S. agona, ubiB deletion mutants, and complemented strains expressing recombinant UbiB to validate phenotypes .

  • Consider environmental variables: Test multiple oxygen conditions (aerobic, microaerobic, anaerobic) to comprehensively assess UbiB's role in the O₂-dependent pathway .

  • Use randomized controlled design: Implement randomization in experimental setup to minimize systematic bias . For biofilm assays, randomize plate positions and reading orders to avoid position effects.

  • Plan for result interpretation: Establish a priori criteria for data analysis and interpretation before conducting experiments . Determine statistical approaches and significance thresholds in advance.

  • Validate with multiple approaches: Combine genetic, biochemical, and physiological methods to build a comprehensive understanding of UbiB function.

When studying biofilm formation, which is relevant to S. agona persistence, crystal violet assays following growth in rich media can provide quantitative measurements of biofilm capacity across different strains . This approach has successfully revealed relationships between biofilm formation and patient carriage status in S. agona isolates.

What are the optimal conditions for expressing recombinant Salmonella agona UbiB protein?

Optimizing recombinant UbiB expression requires systematic evaluation of multiple parameters:

ParameterRecommended ConditionsConsiderations
Expression hostE. coli BL21(DE3), C41(DE3), or C43(DE3)C41/C43 strains are optimized for membrane proteins
Expression vectorpET system with T7 promoterInclude affinity tag (His₆, Strep) for purification
Induction conditions0.1-0.5 mM IPTG, 16-25°CLower temperatures reduce inclusion body formation
Growth mediaTerrific Broth supplemented with 1% glucoseRich media supports higher biomass production
Induction timingMid-log phase (OD₆₀₀ = 0.6-0.8)Optimal balance between growth and protein expression
Harvest time16-20 hours post-inductionExtended expression at lower temperatures
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, mild detergentDetergent choice critical for membrane proteins

The expression system should be designed with randomized controlled experiments to determine optimal conditions . For membrane-associated proteins like UbiB, solubilization conditions are particularly critical. Consider screening multiple detergents (DDM, LDAO, CHAPS) at various concentrations to identify conditions that yield active, properly folded protein.

What genetic manipulation approaches are most effective for studying UbiB in Salmonella agona?

Several genetic approaches can be employed to investigate UbiB function in S. agona:

  • Gene deletion strategies:

    • Allelic exchange using counter-selectable markers (sacB, rpsL)

    • Lambda Red recombination system for efficient homologous recombination

    • CRISPR-Cas9 for scarless, precise deletions

  • Complementation approaches:

    • Plasmid-based expression with inducible promoters

    • Chromosomal integration at neutral sites

    • Complementation with homologs from other species to assess functional conservation

  • Protein tagging methods:

    • C-terminal tags generally preferred to avoid disrupting signal sequences

    • Fluorescent protein fusions for localization studies

    • Affinity tags for protein-protein interaction studies

  • Expression control:

    • Inducible promoters (arabinose, tetracycline-responsive)

    • Native promoter regions to maintain physiological expression levels

    • Riboswitch-based systems for fine-tuned regulation

When designing such experiments, randomization principles should be applied to minimize bias . Additionally, mechanistic details should be clearly defined before experimentation, including hypotheses, experimental design, and plans for result interpretation .

How does oxygen availability affect UbiB activity and ubiquinone biosynthesis in Salmonella agona?

Oxygen availability significantly impacts ubiquinone biosynthesis pathways in proteobacteria. Research indicates that bacteria like S. agona have evolved both O₂-dependent and O₂-independent pathways to synthesize ubiquinone across the entire oxygen range . UbiB is likely involved in the O₂-dependent pathway, while proteins like UbiT, UbiU, and UbiV function in an O₂-independent pathway.

The UbiU-UbiV proteins form a heterodimer, with each protein binding a 4Fe-4S cluster via conserved cysteines that are essential for activity . This mechanism allows for hydroxylation reactions to occur without requiring molecular oxygen. In contrast, UbiB likely participates in hydroxylation reactions that utilize molecular oxygen directly.

To study these relationships experimentally, researchers should:

  • Culture S. agona under precisely controlled oxygen concentrations using appropriate bioreactors

  • Monitor UbiB expression and activity across the oxygen gradient

  • Quantify ubiquinone production using HPLC or LC-MS

  • Compare growth and metabolism of wild-type versus ubiB mutants under different oxygen conditions

This approach will reveal how S. agona modulates its ubiquinone biosynthesis pathways in response to environmental oxygen fluctuations, which is particularly relevant for understanding bacterial adaptation in food production environments and during host infection.

What is the relationship between UbiB function, biofilm formation, and antimicrobial resistance in Salmonella agona?

The relationship between UbiB function, biofilm formation, and antimicrobial resistance in S. agona represents a complex interplay of bacterial physiology:

Biofilm formation is a key persistence mechanism for S. agona in food production environments. Crystal violet assays have revealed variability in biofilm capacity across S. agona isolates, with significant differences observed between isolates from different patient carriage states . Specifically, isolates from patients with convalescent (p = 0.004) and temporary carriage (p = 0.002) demonstrated significantly poorer biofilm ability compared to isolates from patients with acute illness .

Ubiquinone biosynthesis, involving UbiB, may influence biofilm formation through several mechanisms:

  • Energy production for extracellular polymeric substance synthesis

  • Electron transport chain functionality affecting cell adhesion

  • Redox balance maintenance during biofilm maturation

Regarding antimicrobial resistance, multidrug-resistant S. agona isolates have been found to harbor numerous antimicrobial and heavy metal resistance genes on mobile genetic elements . Some isolates carry resistance genes against a minimum of nine antibiotic classes, including beta-lactams, fluoroquinolones, aminoglycosides, and tetracyclines .

UbiB's contribution to antimicrobial resistance may involve:

  • Supporting metabolic functions necessary for expression of resistance determinants

  • Maintaining membrane potential required for efflux pump activity

  • Providing energy for active drug extrusion mechanisms

To investigate these relationships, researchers should employ randomized controlled experimental designs comparing wild-type, ubiB mutant, and complemented strains for biofilm formation capacity and antimicrobial susceptibility profiles under various environmental conditions.

How does the structure of UbiB relate to its function in the ubiquinone biosynthesis pathway?

The structure-function relationship of UbiB in ubiquinone biosynthesis involves several key molecular features:

UbiB belongs to the protein kinase-like superfamily but functions in ubiquinone biosynthesis rather than phosphorylation. Key structural elements likely include:

  • Nucleotide-binding domain: Probably binds ATP to provide energy for catalytic reactions

  • Membrane-association motifs: Facilitate interaction with the bacterial membrane where ubiquinone synthesis occurs

  • Substrate recognition sites: Specifically interact with ubiquinone precursors

  • Potential redox-active centers: May participate in electron transfer during biosynthetic reactions

Unlike the O₂-independent ubiquinone biosynthesis proteins UbiU and UbiV, which form a heterodimer containing 4Fe-4S clusters essential for activity , UbiB likely employs different structural features for its catalytic function. The 4Fe-4S clusters in UbiU-UbiV allow these proteins to perform hydroxylation reactions without requiring molecular oxygen .

To investigate UbiB structure-function relationships, researchers should consider:

  • Site-directed mutagenesis of conserved residues

  • Protein truncation studies to identify functional domains

  • Heterologous expression of chimeric proteins

  • Structural biology approaches (X-ray crystallography, cryo-EM)

Experimental designs should follow rigorous methodological principles, including randomization and clear a priori decisions about result interpretation .

How should researchers analyze and interpret data from UbiB knockout experiments in Salmonella agona?

Analysis and interpretation of UbiB knockout data requires rigorous methodological approaches:

  • Growth phenotype analysis:

    • Compare growth curves of wild-type, ΔubiB, and complemented strains using area under the curve (AUC) calculations

    • Apply repeated measures ANOVA for time-course data with appropriate post-hoc tests

    • Normalize for initial cell density variations using log-transformation

  • Ubiquinone quantification:

    • Employ HPLC or LC-MS for precise ubiquinone measurement

    • Normalize to total lipid content or cell dry weight

    • Compare across oxygen conditions to detect pathway switching

  • Transcriptomic/proteomic changes:

    • Identify compensatory mechanisms using differential expression analysis

    • Apply pathway enrichment to contextualize results

    • Validate key findings with targeted RT-qPCR or Western blotting

  • Statistical considerations:

    • Establish significance thresholds a priori (typically p < 0.05 with appropriate corrections)

    • Calculate effect sizes (Cohen's d) to determine biological significance

    • Perform power analysis to ensure adequate sample size

When interpreting results, researchers should consider potential confounding factors such as polar effects on adjacent genes and compensatory mechanisms. The experimental design should include randomization principles to minimize bias and clear pre-established criteria for result interpretation .

For biofilm formation analysis, crystal violet assays can provide quantitative measurements, as demonstrated in previous S. agona studies . Statistical comparisons between wild-type and knockout strains should account for biological variability by including multiple biological replicates and appropriate controls.

What challenges exist in distinguishing between direct and indirect effects of UbiB manipulation in Salmonella agona?

Distinguishing between direct and indirect effects of UbiB manipulation presents several methodological challenges:

  • Metabolic network complexity:

    • Ubiquinone participates in numerous cellular processes

    • Perturbation of UbiB affects entire electron transport chain

    • Secondary metabolic adaptations can mask primary effects

  • Compensatory mechanisms:

    • Alternative ubiquinone biosynthesis pathways may activate (UbiT/U/V)

    • Global regulatory responses can obscure direct UbiB effects

    • Stress responses may be triggered independently of ubiquinone depletion

  • Temporal considerations:

    • Immediate versus long-term adaptations differ substantially

    • Evolution of suppressor mutations during experiments

    • Time-dependent changes in phenotypic manifestations

  • Technical challenges:

    • Limited specificity of metabolic inhibitors

    • Difficulties in precisely controlling ubiquinone levels

    • Membrane disruption during sample preparation

To address these challenges, researchers should:

  • Employ temporally resolved experiments (minutes to generations)

  • Use inducible systems for acute UbiB depletion/overexpression

  • Combine genetic and biochemical approaches

  • Develop quantitative models incorporating pathway dynamics

  • Apply metabolic flux analysis to trace ubiquinone metabolism

Experimental design should follow randomized controlled principles with clear a priori decisions about result interpretation . Multiple complementary approaches should be used to triangulate findings and build a coherent understanding of direct versus indirect UbiB effects.

How should contradictory findings regarding UbiB function across different bacterial species be reconciled?

Reconciling contradictory findings regarding UbiB function across bacterial species requires a systematic analytical framework:

When designing experiments to resolve contradictions, randomized controlled approaches should be employed , with clear methodological guidelines established before experimentation . This systematic approach will help determine whether apparent contradictions reflect genuine biological differences or methodological variations.

What emerging technologies show promise for advancing UbiB research in Salmonella agona?

Several emerging technologies offer significant potential for advancing UbiB research:

  • CRISPR-based approaches:

    • CRISPRi for tunable repression of ubiB expression

    • CRISPRa for targeted upregulation of pathway components

    • Base editing for precise single nucleotide modifications

    • Multiplex CRISPR for simultaneous modification of pathway genes

  • Advanced imaging techniques:

    • Super-resolution microscopy for UbiB localization

    • Single-molecule tracking to observe UbiB dynamics

    • FRET-based biosensors for real-time activity monitoring

    • Correlative light-electron microscopy for structural context

  • Systems biology tools:

    • Multi-omics integration for pathway modeling

    • Genome-scale metabolic models incorporating ubiquinone biosynthesis

    • Flux balance analysis to quantify metabolic impacts

    • Network perturbation analysis to identify regulatory connections

  • Structural biology advances:

    • Cryo-EM for membrane protein complexes

    • Hydrogen-deuterium exchange mass spectrometry for dynamic interactions

    • Molecular dynamics simulations of UbiB function

    • AlphaFold2-predicted structures to guide experimental design

When implementing these technologies, experimental design should adhere to randomization principles and include clear a priori decisions about result interpretation . The ideal approach would combine multiple complementary technologies to build a comprehensive understanding of UbiB function in S. agona.

How might understanding UbiB function contribute to novel antimicrobial strategies against Salmonella agona?

Understanding UbiB function could inform novel antimicrobial strategies through several avenues:

  • Direct targeting approaches:

    • Small molecule inhibitors of UbiB enzymatic activity

    • Peptide-based inhibitors disrupting protein-protein interactions

    • Allosteric modulators affecting UbiB conformational states

    • Structure-based design of transition-state analogs

  • Pathway vulnerability exploitation:

    • Identification of synthetic lethal interactions with UbiB

    • Targeting pathway bottlenecks in ubiquinone biosynthesis

    • Disruption of compensatory mechanisms (UbiT/U/V pathway)

    • Combination therapies targeting both O₂-dependent and O₂-independent pathways

  • Host-pathogen interface targeting:

    • Modulation of host redox environment to stress bacterial metabolism

    • Immunomodulatory approaches enhancing oxidative burst effectiveness

    • Biofilm disruption strategies based on ubiquinone dependence

    • Host-directed therapies that indirectly impact bacterial energetics

  • Resistance management strategies:

    • Evolutionary constraint mapping to identify resistance barriers

    • Collateral sensitivity exploitation between antibiotics and UbiB inhibitors

    • Adaptive treatment regimens based on oxygen availability

    • Biomarkers for predicting susceptibility to UbiB-targeting compounds

The prevalence of multidrug-resistant S. agona isolates carrying resistance genes against multiple antibiotic classes underscores the need for novel antimicrobial approaches. Targeting essential metabolic pathways like ubiquinone biosynthesis represents a promising strategy, particularly given the importance of this pathway across various oxygen conditions .

What are the knowledge gaps in understanding the evolution of ubiquinone biosynthesis pathways in Salmonella and related bacteria?

Several significant knowledge gaps exist in our understanding of ubiquinone biosynthesis pathway evolution:

  • Evolutionary origins and diversification:

    • Relationship between O₂-dependent (UbiB) and O₂-independent (UbiT/U/V) pathways

    • Horizontal gene transfer patterns of ubiquinone biosynthesis genes

    • Selection pressures driving pathway conservation versus innovation

    • Ancestral states of ubiquinone biosynthesis in proteobacteria

  • Functional redundancy and specialization:

    • Conditions favoring maintenance of dual pathways

    • Species-specific differences in pathway utilization

    • Regulatory integration between pathways

    • Trade-offs between pathway efficiency and metabolic flexibility

  • Ecological adaptations:

    • Correlation between ecological niches and pathway preferences

    • Role in host-associated versus environmental lifestyles

    • Adaptations to specific oxygen regimes

    • Connection to biofilm formation capacity and persistence

  • Structural evolution:

    • Conservation of critical protein domains across species

    • Coevolution patterns within pathway components

    • Structural basis for O₂ dependency versus independence

    • Evolution of protein-protein interactions within biosynthetic complexes

Addressing these knowledge gaps will require interdisciplinary approaches combining comparative genomics, biochemistry, structural biology, and evolutionary modeling. Experimental designs should follow randomized controlled principles with clear methodological guidelines established before experimentation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.