Recombinant Salmonella agona Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Prolipoprotein Diacylglyceryl Transferase (Lgt) is an inner-membrane enzyme that catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of bacterial prolipoproteins, initiating their maturation . In Salmonella agona (strain SL483), Lgt is encoded by the lgt gene (locus tag: SeAg_B3149) and is essential for bacterial growth and membrane integrity .

Enzyme Mechanism

Lgt transfers a diacylglyceryl moiety to the thiol group of the lipobox cysteine ([LVI][ASTVI][GAS]C motif) in prolipoproteins, forming a thioether bond . This modification is a prerequisite for subsequent processing by signal peptidase LspA and N-acyltransferase Lnt .

Essentiality in Bacterial Survival

  • Lgt is indispensable for Salmonella viability. Depletion disrupts outer membrane integrity, increasing susceptibility to antibiotics and host defenses .

  • In E. coli, lgt knockout mutants exhibit lethal phenotypes unless rescued by exogenous Lgt .

Therapeutic Targeting

  • Lgt inhibitors (e.g., palmitic acid analogs) exhibit bactericidal activity against E. coli and Acinetobacter baumannii, validating Lgt as a drug target .

  • Unlike downstream lipoprotein biogenesis steps, Lgt inhibition is not circumvented by deletion of the major outer membrane lipoprotein Lpp .

Comparative Analysis Across Bacterial Species

SpeciesLgt Identity to S. agonaFunctional Conservation
Staphylococcus aureus24%Complements E. coli Lgt mutants
Haemophilus influenzae47% similarityConserved catalytic core
E. coliHydropathy profile matchEssential for growth

Product Variants

Product CodeSourceTagPrice (USD)Availability
CSB-EP479610SWK1-BE. coliVariable $1,642Limited
CSB-MP479610SWK1MammalianVariable $1,642Limited

Reconstitution and Stability

  • Reconstitution: 0.1–1.0 mg/mL in deionized water with 5–50% glycerol .

  • Shelf Life: 6 months (liquid, -80°C); 12 months (lyophilized) .

Implications for Salmonella Pathogenesis

  • S. agona employs biofilm formation and genomic plasticity to establish persistent infections . While Lgt is not directly linked to biofilm regulation, its role in lipoprotein maturation likely supports membrane stability during host adaptation .

  • Persistent S. agona isolates show reduced biofilm capacity, suggesting transcriptional or post-translational modulation of virulence factors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery information, please consult your local distributor.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
lgt; SeAg_B3149; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (Lgt) in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the critical first step in bacterial lipoprotein biosynthesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved +1 position cysteine in the lipobox sequence [LVI][ASTVI][GAS]C of prelipoproteins via a thioether bond . This modification is essential for the anchoring of lipoproteins to bacterial membranes.

In Gram-negative bacteria like Salmonella and E. coli, this process is part of a three-step pathway involving:

  • Diacylglyceryl transfer by Lgt

  • Signal peptide cleavage by prolipoprotein signal peptidase (LspA)

  • N-acylation by lipoprotein N-acyl transferase (Lnt)

The mature lipoproteins subsequently play crucial roles in bacterial growth, outer membrane integrity, and pathogenesis .

How does the structure of Lgt relate to its function in Salmonella agona compared to other bacterial species?

Lgt in Salmonella agona shares significant structural homology with other Gram-negative bacteria, particularly E. coli. Sequence analysis reveals that Lgt maintains several highly conserved domains across bacterial species, including the characteristic "Lgt signature motif" containing invariant residues . The amino acid sequence of S. agona Lgt (UniProt B5F4U6) contains the critical H-GGLIG motif (residues 103-108) that is essential for enzymatic function .

Topology studies using E. coli Lgt as a model have demonstrated that the enzyme is embedded in the inner membrane by seven transmembrane segments, with its N-terminus facing the periplasm and C-terminus facing the cytoplasm . Key functional residues identified through alanine substitution experiments in E. coli include Y26, N146, and G154, which are absolutely required for Lgt function, along with R143, E151, R239, and E243 . These residues are also conserved in S. agona Lgt, indicating functional conservation.

While there is 24% identity and 47% similarity between Gram-positive (S. aureus) and Gram-negative (E. coli, S. typhimurium, H. influenzae) Lgt proteins , the functional domains remain conserved, suggesting evolutionary pressure to maintain the catalytic mechanism across diverse bacterial species.

What are the most effective methods for expressing and purifying recombinant Salmonella agona Lgt for in vitro studies?

Expression Systems Comparison:

Recombinant S. agona Lgt can be expressed using several systems, each with specific advantages:

Expression SystemAdvantagesLimitationsYieldNative Folding
Mammalian cell linesSuperior post-translational modificationsHigher cost, longer production timeModerate (50-100 μg/L)Excellent
E. coliCost-effective, rapid, high yieldInclusion body formation commonHigh (1-5 mg/L)Variable
Insect cellsGood for membrane proteinsModerate costGood (0.5-2 mg/L)Very good

Purification Protocol:

  • Cell lysis under native conditions using a gentle detergent (e.g., n-dodecyl β-D-maltoside)

  • Affinity chromatography using His-tag or other suitable fusion tags

  • Size exclusion chromatography for increased purity

  • Storage in Tris-based buffer with 50% glycerol at -20°C to -80°C

Critical Considerations:

  • Maintain detergent concentration above critical micelle concentration throughout purification

  • Avoid repeated freeze-thaw cycles as noted in product handling guidelines

  • For functional studies, reconstitution in phospholipid vesicles may be necessary to maintain activity

What assays can be used to measure Lgt enzymatic activity in vitro and in bacterial cells?

In Vitro Biochemical Assays:

  • Glycerol Phosphate Release Assay:
    This coupled luciferase-based assay measures the release of glycerol phosphate as a by-product of the Lgt-catalyzed reaction. Using a synthetic peptide substrate derived from bacterial lipoproteins (e.g., Pal-IAAC), the assay can detect both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) depending on the phosphatidylglycerol substrate used . IC₅₀ values for Lgt inhibitors can be determined using this method.

  • Radiolabeling Assay:
    This approach involves the use of radiolabeled phosphatidylglycerol (typically ³²P-labeled) as substrate and measuring the transfer of the diacylglyceryl moiety to a peptide substrate through autoradiography or scintillation counting.

Cellular Assays:

  • Metabolic Labeling:
    Bacterial cultures are grown in the presence of [¹⁴C]-palmitic acid, allowing incorporation into lipoproteins via the Lgt pathway. Cellular proteins are then extracted, separated by SDS-PAGE, and analyzed by autoradiography. In Lgt-deficient strains, no labeled proteins are detected, confirming Lgt activity .

  • Western Blot Analysis of Lipoprotein Processing:
    This method tracks the accumulation of unmodified prolipoproteins (UPLP) versus diacylglyceryl-modified prolipoproteins (DGPLP) using antibodies against specific lipoproteins (e.g., Lpp). SDS fractionation can separate peptidoglycan-linked and non-linked forms .

  • Membrane Fractionation:
    Sucrose gradient centrifugation or sarkosyl treatment can be used to isolate inner membrane fractions, followed by quantification of accumulated lipoprotein intermediates in wild-type versus Lgt-deficient or Lgt-inhibited bacteria .

How can we generate and characterize Lgt deletion or depletion mutants in Salmonella species?

Generation of Lgt Mutants:

  • Inducible Depletion System:
    Due to the essential nature of Lgt in many Gram-negative bacteria , an inducible depletion system is often preferable to direct gene deletion:

    • Replace the native promoter with an inducible promoter (e.g., arabinose-inducible araBAD promoter)

    • Add a degradation tag for rapid protein turnover upon inducer removal

    • Culture under inducing conditions until depletion experiments

  • Direct Deletion Methods:

    • Cre-loxP System: As demonstrated in B. anthracis , this approach allows for markerless deletion of the lgt gene

    • Lambda Red Recombination: For efficient homologous recombination in Salmonella

    • CRISPR-Cas9: For precise genome editing without leaving selection markers

Confirmation of Mutant Construction:

  • PCR verification using primers flanking the deleted region

  • Sequencing to confirm precise deletion or modification

  • RT-qPCR to verify transcriptional changes

  • Western blotting to confirm absence of Lgt protein

Phenotypic Characterization:

PhenotypeMethod of AssessmentExpected Outcome in Lgt Mutants
Growth characteristicsGrowth curves in liquid mediaExtended lag phase, possible growth defects
Membrane integrityDye uptake assays (propidium iodide)Increased permeability
Antibiotic sensitivityMinimum inhibitory concentration (MIC)Increased sensitivity to multiple antibiotics
Serum resistanceSerum survival assayDecreased survival in serum
Lipoprotein processing[¹⁴C]palmitic acid labelingAbsence of labeled lipoproteins
Surface hydrophobicityHydrocarbon partitioningDecreased surface hydrophobicity

What phenotypic changes result from Lgt mutation or inhibition in Salmonella, and how do these compare to other bacterial species?

Phenotypic Consequences in Salmonella:

Like other Gram-negative bacteria, Lgt depletion or inhibition in Salmonella likely results in:

  • Compromised outer membrane integrity

  • Increased sensitivity to antibiotics and antimicrobial peptides

  • Altered biofilm formation capacity

  • Potential attenuation of virulence

  • Accumulation of unprocessed prolipoproteins

Comparative Analysis Across Bacterial Species:

Bacterial SpeciesGrowth PhenotypeMembrane EffectsVirulence ImpactReference
E. coli (Gram-negative)Essential for growth; Lgt depletion is lethalPermeabilization of outer membraneIncreased sensitivity to serum killing and antibiotics
Acinetobacter baumannii (Gram-negative)Lgt inhibitors are bactericidalMembrane integrity compromisedNot fully characterized
Streptococcus suis (Gram-positive)Viable with slightly increased lag phaseAbolished lipidation of lipoproteinsAltered interaction with host immune system
Bacillus anthracis (Gram-positive)ViableDecreased surface hydrophobicitySpores show attenuated virulence; vegetative cells maintain virulence

Key Differences Between Gram-Positive and Gram-Negative Bacteria:

  • Lgt is essential in many Gram-negative bacteria but not in all Gram-positive bacteria

  • In B. anthracis, Lgt deletion specifically affects spore germination efficiency, while vegetative cells maintain virulence

  • In S. suis, Lgt mutants remain viable with only slightly increased lag phase

These differences highlight the varied roles of lipoproteins in different bacterial envelope architectures and suggest that targeting Lgt might have different therapeutic implications depending on the bacterial species.

How can Lgt be targeted for novel antimicrobial development, and what are the mechanisms of resistance to Lgt inhibitors?

Lgt as an Antimicrobial Target:

Recent research has identified the first Lgt inhibitors (Lgti) that potently inhibit Lgt biochemical activity in vitro and demonstrate bactericidal activity against wild-type Acinetobacter baumannii and E. coli strains . These compounds (designated G9066, G2823, and G2824) inhibit Lgt with IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively .

Advantages of Lgt as a Target:

  • Reduced Resistance Development: Unlike inhibitors of downstream steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors

  • Essential Function: Lgt is essential for growth in many Gram-negative bacteria

  • Broad Spectrum Potential: Conserved across diverse bacterial species

Mechanism of Action of Lgt Inhibitors:
The identified Lgti compounds appear to act through specific inhibition of the diacylglyceryl transferase activity, leading to:

  • Accumulation of unmodified prolipoproteins (UPLP) in the inner membrane

  • Minimal accumulation of inefficiently peptidoglycan-linked UPLP

  • No significant accumulation of other peptidoglycan-linked lipoprotein forms, including DGPLP

Resistance Mechanisms:
Interestingly, researchers were unable to raise on-target resistant mutants to any Lgti compounds . This contrasts with other antimicrobial targets and suggests potential explanations:

  • If Lgti compounds bind to the conserved phosphatidylglycerol binding site in Lgt, mutations disrupting this binding might result in loss of Lgt function, leading to cell death

  • Similar to globomycin (which targets LspA), no on-target resistance mutations have been described for inhibitors binding highly conserved active sites

This characteristic makes Lgt an especially promising antimicrobial target, as conventional resistance mechanisms through target modification may be less likely to develop.

What are common challenges when working with recombinant Lgt, and how can they be addressed in laboratory settings?

Challenge 1: Protein Stability and Storage

Recombinant Lgt, as a membrane protein, faces stability challenges:

IssueSolutionRationale
Protein degradation during storageStore in 50% glycerol at -20°C/-80°C Glycerol prevents water crystal formation and stabilizes protein structure
Loss of activity after freeze-thaw cyclesAliquot protein and limit freeze-thaw cycles to one Repeated freeze-thaw damages protein structure
AggregationAdd non-ionic detergents (0.1% n-dodecyl β-D-maltoside)Prevents hydrophobic interactions between transmembrane domains

Challenge 2: Functional Assay Optimization

IssueSolutionTechnical Consideration
Low enzymatic activityOptimize buffer conditions (pH 7.2-7.4, 150-200 mM NaCl)Lgt activity is pH-dependent
Poor substrate recognitionUse substrate derived from native lipoproteins (e.g., Pal-IAAC where C is the conserved cysteine) Ensures proper substrate specificity
Inconsistent assay readoutImplement the coupled luciferase reaction for G3P detection Provides sensitive and quantitative measurement

Challenge 3: Expression and Purification

IssueSolutionExpected Outcome
Inclusion body formationLower induction temperature (16-20°C)Allows proper folding
Low yieldUse mammalian expression systems Better for membrane proteins
Purity concernsImplement two-step purification (affinity + size exclusion) Achieves >85% purity (SDS-PAGE)

Best Practices for Working with Recombinant Lgt:

  • Quality Control: Verify protein functionality before experiments using a simplified activity assay

  • Experimental Design: Include appropriate positive and negative controls (e.g., heat-inactivated Lgt, Lgt with mutated catalytic residues)

  • Data Interpretation: Consider the presence of detergents when interpreting interaction studies

  • Collaboration: Partnering with structural biology groups can provide insights into protein conformation and activity

How can we design experiments to investigate Lgt interactions with other components of the lipoprotein processing pathway?

Experimental Approaches to Study Lgt Interactions:

  • Protein-Protein Interaction Studies:

    MethodApplicationAdvantagesLimitations
    Bacterial Two-Hybrid (BACTH)Screen for interactions between Lgt and other membrane proteinsWorks with membrane proteinsMay give false positives
    Co-immunoprecipitationVerify direct interactionsDetects native complexesRequires specific antibodies
    Surface Plasmon ResonanceMeasure binding kineticsQuantitative dataRequires purified proteins
    Crosslinking assaysCapture transient interactionsWorks in native environmentMay capture non-specific interactions
  • Functional Interactions with Lipoprotein Processing Components:

    Sequential Processing Analysis:

    • Generate conditional mutants for lgt, lspA, and lnt genes

    • Use Western blotting to detect accumulation of different lipoprotein intermediates

    • Compare effects of single vs. double depletion to identify synergistic relationships

    Substrate Specificity Investigation:

    • Create a library of artificial lipoprotein substrates with variations in the lipobox sequence

    • Measure Lgt processing efficiency for each variant

    • Identify key determinants of substrate recognition

  • Membrane Localization and Dynamics:

    TechniqueApplicationExpected Results
    GFP fusion proteinsVisualize Lgt localizationPunctate inner membrane distribution
    FRAP (Fluorescence Recovery After Photobleaching)Measure Lgt mobility in membraneLimited lateral diffusion
    Super-resolution microscopyDetect co-localization with other pathway componentsPotential processing complexes
  • Structural Studies of Interaction Interfaces:

    Site-Directed Mutagenesis:

    • Target conserved residues (particularly in the H-GGLIG motif)

    • Assess effects on interactions with other pathway components

    • Map critical interaction interfaces

    Chimeric Protein Analysis:

    • Create chimeras between S. agona Lgt and Lgt from other species

    • Determine which domains confer species-specific interactions

    • Identify evolutionarily conserved interaction motifs

Experimental Design Considerations:

  • Controls: Include wild-type proteins, catalytically inactive mutants, and unrelated membrane proteins

  • Membrane Environment: Ensure appropriate membrane mimetics (nanodiscs, liposomes) for in vitro studies

  • Physiological Relevance: Validate interactions under different growth conditions that might affect membrane composition

  • Quantitative Analysis: Implement multiple methods to confirm interactions and measure binding affinities

These approaches will provide comprehensive insights into how Lgt functions within the broader context of the lipoprotein processing pathway in Salmonella agona and related bacterial species.

What are emerging areas of research regarding Lgt function beyond its canonical role in lipoprotein processing?

Recent findings suggest that Lgt may play broader roles beyond the well-established lipoprotein processing pathway:

  • Stress Response Regulation:

    • In B. anthracis, Lgt deletion affects spore germination but not vegetative cell virulence , suggesting potential involvement in stress adaptation mechanisms

    • Investigation of Lgt expression under various stress conditions (nutrient limitation, antimicrobial exposure) could reveal regulatory roles

  • Protein Quality Control Systems:

    • The accumulation of specific Lpp isoforms (~14 kDa) in Lgt-depleted or pharmacologically inhibited cells suggests potential interactions with protein quality control mechanisms

    • This may represent a novel biological response to lipoprotein processing disruption

  • Biofilm Formation and Persistence:

    • S. agona is recognized for its strong biofilm formation capabilities and ability to enter a viable but non-culturable state

    • Research examining how Lgt activity influences these phenotypes could reveal new functions in bacterial persistence

  • Host-Pathogen Interactions:

    • Beyond TLR2 activation, Lgt-processed lipoproteins may interact with other host receptors

    • Systematic screening of host factors interacting with Lgt-modified proteins could identify novel immune evasion mechanisms

  • Metabolic Integration:

    • Lgt utilizes phosphatidylglycerol as a substrate, potentially linking lipoprotein processing to phospholipid metabolism

    • Investigating how Lgt activity responds to changes in membrane lipid composition could reveal regulatory mechanisms

Methodological Approaches for Exploring Non-Canonical Functions:

  • Multi-omics approaches (proteomics, lipidomics, transcriptomics) comparing wild-type and Lgt-deficient strains

  • Synthetic genetic array analysis to identify genetic interactions

  • Proximity-dependent biotin labeling to identify novel protein-protein interactions in vivo

How might comparative genomics and evolutionary studies of Lgt across bacterial species inform our understanding of bacterial adaptation and pathogenesis?

Evolutionary Analysis of Lgt:

The Lgt protein shows varying degrees of conservation across bacterial species, with 24% identity and 47% similarity between Gram-positive (S. aureus) and Gram-negative (E. coli, S. typhimurium, H. influenzae) Lgt proteins . This conservation pattern raises important evolutionary questions that could be addressed through comparative genomics:

  • Selective Pressures on Lgt:

    • Analysis of dN/dS ratios across Lgt sequences from diverse bacteria could identify regions under positive or purifying selection

    • Correlation with bacterial lifestyle (pathogenic vs. commensal, host range) might reveal adaptation signatures

  • Co-evolution with Lipoprotein Substrates:

    • Examination of how Lgt and its lipoprotein substrates co-evolve could reveal evolutionary constraints

    • Identification of complementary changes in Lgt and lipoprotein signal sequences across species

  • Horizontal Gene Transfer and Lgt Diversity:

    • Analysis of Lgt phylogeny compared to species phylogeny could reveal horizontal gene transfer events

    • Investigation of Lgt in S. agona isolates from diverse sources might show adaptation to specific niches

Comparative Genomics Approaches:

  • Synteny Analysis:

    • Examining gene neighborhoods around lgt across bacteria

    • In Streptococcus suis, lgt is part of an operon expressing 4 genes , suggesting functional relationships

  • Correlation with Antimicrobial Resistance:

    • Analysis of S. agona isolates carrying multidrug resistance plasmids could reveal whether Lgt variation correlates with resistance phenotypes

    • Investigation of whether Lgt variability affects efficacy of membrane-targeting antimicrobials

  • Host Adaptation Signatures:

    • Comparison of Lgt sequences from bacteria adapted to different hosts

    • Identification of host-specific selection pressures on lipoprotein processing

  • Pathogenicity Islands and Virulence Association:

    • Assessment of whether lgt is associated with pathogenicity islands or mobile genetic elements

    • Correlation of Lgt sequence variants with virulence phenotypes across clinical isolates

Potential Applications of Evolutionary Insights:

  • Improved Antimicrobial Design:

    • Identification of universally conserved residues as optimal drug targets

    • Development of species-specific inhibitors based on unique structural features

  • Vaccine Development:

    • Design of recombinant live-attenuated Salmonella vaccines with optimized Lgt function for controlled attenuation

    • Identification of conserved lipoprotein epitopes processed by Lgt as potential vaccine candidates

  • Diagnostic Applications:

    • Development of molecular diagnostic tools based on Lgt sequence variations

    • Identification of Lgt-processed lipoproteins as biomarkers for specific bacterial infections

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.