Recombinant Salmonella agona Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant GlpG is produced using heterologous expression systems, with protocols optimized for yield and purity:

Expression Systems

  • Hosts: E. coli, yeast, baculovirus, or mammalian cells .

  • Induction: Typically induced with arabinose (for pBAD vectors) or IPTG .

Purification Methods

  • Immobilized Metal Affinity Chromatography (IMAC): His-tagged GlpG is purified using nickel-nitrilotriacetic acid (Ni-NTA) resin .

  • Size Exclusion Chromatography (SEC): Further refines purity and removes aggregates .

ParameterSpecification
Purity≥85–90% (SDS-PAGE)
Yield1–2.5 mg per liter of culture
StorageTris/PBS buffer with 50% glycerol, -80°C

Substrate Specificity

GlpG cleaves substrates with destabilizing residues (e.g., proline) in their TMDs, such as orphan subunits of respiratory complexes (e.g., HybA, FdnH) . Activity depends on substrate oligomeric status—orphan proteins lacking binding partners are selectively degraded .

Conformational Dynamics

Crystallographic studies reveal that inhibitor binding (e.g., phosphonofluoridates) induces structural rearrangements in GlpG’s extracellular L1 loop and TMD5, stabilizing the active site .

Quality Control in Bacteria

GlpG mediates proteolytic quality control of misfolded or unassembled membrane proteins, preventing cytotoxicity . For example:

  • Cleaves orphan subunits of Shigella hydrogenase-2 and formate dehydrogenase complexes .

  • Ensures metabolic efficiency by degrading non-functional proteins under anaerobic conditions .

Pathogenesis and Colonization

In Escherichia coli and Salmonella, GlpG enhances bacterial persistence in the gut by regulating glycerol metabolism and fatty acid utilization . Mutants lacking glpG show impaired survival in murine colonization models .

Biotechnological Applications

  • Structural Studies: Used for X-ray crystallography and inhibitor binding assays .

  • Enzymatic Assays: Quantifies intramembrane protease activity using fluorogenic substrates .

  • Drug Discovery: Target for antimicrobial agents due to its role in bacterial fitness .

Comparative Analysis with Orthologs

GlpG shares functional homology with rhomboid proteases across bacterial species:

SpeciesProteaseKey SubstratesBiological Role
Salmonella agonaGlpGHybA, FdoH, FdnH Orphan protein degradation
Providencia stuartiiAarATatA Quorum sensing
Haemophilus influenzaeHiGlpGUncharacterizedStructural studies

Challenges and Future Directions

  • Substrate Identification: Few natural substrates are known due to conditional expression and partner-dependent cleavage .

  • Mechanistic Studies: Role of the seventh TMD in Rhom7 (a GlpG paralog) remains unexplored .

  • Therapeutic Potential: Inhibitors targeting GlpG could disrupt bacterial colonization without affecting host proteases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; SeAg_B3725; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella agona Rhomboid protease glpG and what are its key characteristics?

Recombinant Salmonella agona Rhomboid protease glpG is an intramembrane serine protease (EC 3.4.21.105) that cleaves transmembrane protein substrates. The protein functions as a membrane-embedded enzyme that catalyzes proteolysis within the lipid bilayer. The full-length protein contains 276 amino acids with a molecular structure that includes multiple transmembrane domains that form a catalytic core within the membrane environment . The protein from Salmonella agona strain SL483 has the UniProt accession number B5F8P0 and contains characteristic sequence motifs found in rhomboid family proteases. The amino acid sequence includes critical catalytic residues necessary for its proteolytic function and substrate recognition domains that facilitate interaction with transmembrane substrates .

Rhomboid proteases like glpG have acquired diverse biological functions during evolution, many of which are relevant to pathogenesis and bacterial physiology. They represent an important protein family for understanding fundamental mechanisms of intramembrane proteolysis and bacterial cell signaling systems .

What are the critical considerations for experimental design when studying Recombinant Salmonella agona Rhomboid protease glpG?

Experimental design is crucial for obtaining reliable results when studying rhomboid proteases like glpG. Researchers should implement the following best practices to avoid common pitfalls:

A carefully designed experimental approach is essential since confounding variables can obscure true associations between genetic or protein factors to the point where real biological phenomena cannot be distinguished from experimental artifacts .

What expression systems and purification methods are recommended for Recombinant Salmonella agona Rhomboid protease glpG?

Based on general protocols for membrane proteins and specific information about glpG, researchers should consider the following expression and purification approaches:

Expression Systems:

  • E. coli expression systems: Commonly used for bacterial membrane proteins like glpG, with options including BL21(DE3), C41(DE3), or C43(DE3) strains that are engineered for membrane protein overexpression.

  • Insect cell systems: For cases where E. coli expression yields insufficient functional protein, baculovirus-insect cell expression may provide better folding and activity.

Purification Methodology:

  • Membrane fraction isolation: Cell lysis followed by differential centrifugation to isolate membrane fractions containing the expressed glpG protein.

  • Detergent solubilization: Careful selection of detergents (e.g., DDM, LMNG, or GDN) to solubilize the membrane protein while maintaining its native structure and activity.

  • Affinity chromatography: Utilizing His-tag or other fusion tags for initial purification step.

  • Size exclusion chromatography: For further purification and to confirm proper oligomeric state.

Storage Considerations:
According to available product information, purified recombinant Salmonella agona Rhomboid protease glpG should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What assays are effective for measuring the activity and substrate specificity of Salmonella agona Rhomboid protease glpG?

Several approaches have been developed to study rhomboid protease activity and can be applied to Salmonella agona glpG:

In vitro Proteolytic Assays:

  • Fluorogenic substrate assays: Using peptides with fluorescence resonance energy transfer (FRET) pairs that change fluorescence upon cleavage.

  • SDS-PAGE and western blotting: To visualize cleavage of purified substrate proteins.

  • Mass spectrometry: For precise identification of cleavage sites within substrates.

Substrate Interaction Studies:

  • Cysteine accessibility methods: As described in research with E. coli GlpG, these can investigate substrate unfolding and interaction with the protease .

  • Optical tweezers experiments: These provide insights into the mechanical unfolding of substrate transmembrane domains, a prerequisite for intramembrane cleavage .

Inhibitor Studies:
Based on E. coli GlpG research, diisopropyl fluorophosphate has been identified as a covalent inhibitor, and similar approaches using peptidomimetics incorporating reactive phosphonate groups could be applied to study Salmonella agona glpG . These inhibitor studies can help characterize the catalytic mechanism and substrate specificity.

Structural Studies:
X-ray crystallography of GlpG-inhibitor complexes has provided valuable insights into the catalytic mechanism of rhomboid proteases . Similar approaches could be applied to Salmonella agona glpG to understand its specific structural features and substrate interactions.

How might Salmonella agona Rhomboid protease glpG contribute to antimicrobial resistance mechanisms?

While direct evidence linking Salmonella agona glpG to antimicrobial resistance is limited in the provided research, several potential mechanisms can be hypothesized based on related studies:

  • Membrane protein processing: As an intramembrane protease, glpG may process membrane proteins involved in drug efflux or uptake, potentially modifying the cell's permeability to antibiotics.

  • Stress response regulation: Rhomboid proteases can participate in stress response pathways that contribute to bacterial survival under antibiotic pressure.

  • Interaction with resistance determinants: Recent research on multidrug-resistant Salmonella enterica has identified numerous antibiotic resistance genes (ARGs) associated with mobile genetic elements . While glpG itself is not typically classified as an ARG, it could potentially interact with resistance mechanisms through regulatory pathways.

In one study of multidrug-resistant Salmonella enterica, researchers identified 23 different antibiotic resistance genes conferring resistance to 12 different antibiotic drug classes, as well as genes conferring resistance to six different heavy metals . The detailed genetic characterization revealed that most resistance genes were organized in distinct clusters associated with mobile genetic elements, suggesting complex resistance mechanisms that might involve regulatory proteins like glpG in their expression or function .

What role does Salmonella agona Rhomboid protease glpG play in bacterial pathogenesis and persistence?

Rhomboid proteases have been implicated in various aspects of bacterial pathogenesis, though specific evidence for Salmonella agona glpG's role remains to be fully elucidated. Based on the available research, several potential functions can be considered:

  • Contribution to persistent infection: Recent phylogenomic studies of Salmonella Agona infections in the UK (2004-2020) identified distinct genome structures, with rearrangements typically associated with early, convalescent carriage (3 weeks to 3 months) . While not explicitly linked to glpG function, these findings suggest genomic adaptations occur during the transition from acute to persistent infection.

  • Membrane protein regulation: As an intramembrane protease, glpG likely processes membrane proteins that could influence host-pathogen interactions.

  • Biofilm formation: The UK Salmonella Agona study mentioned analyzing biofilm formation capability , a trait that contributes to bacterial persistence. Rhomboid proteases could potentially influence biofilm development through processing of adhesins or other surface proteins.

The following table summarizes potential roles of rhomboid proteases in bacterial pathogenesis based on current understanding:

Potential FunctionMechanismEvidence Level
Virulence factor processingProteolytic activation/inactivation of bacterial virulence factorsDemonstrated in some species, hypothetical for Salmonella agona
Stress responseProcessing of membrane proteins involved in stress signalingModerate evidence across bacterial species
Biofilm formationRegulation of surface adhesins or matrix componentsLimited, requires further investigation
Persistent infectionAdaptation to host environment through proteolytic regulationCorrelative based on genome structure studies
Host cell invasionProcessing of invasion factorsDemonstrated in parasites (e.g., Plasmodium), limited evidence in bacteria

What structural and functional analyses have advanced our understanding of rhomboid protease mechanisms?

Structural and functional analyses have provided significant insights into the catalytic mechanism of rhomboid proteases. While many studies focus on E. coli GlpG rather than Salmonella agona specifically, these findings inform our understanding of all bacterial rhomboid proteases:

  • X-ray crystallography: Structures of E. coli rhomboid GlpG and its complexes with mechanism-specific inhibitors have been determined, revealing the structural basis for catalysis .

  • Exosite identification: Research has identified that substrate's transmembrane domain docks onto an exosite on GlpG and induces a conformational change that activates the protease . This allosteric mechanism is likely conserved across rhomboid proteases.

  • Substrate unfolding studies: Cysteine accessibility and optical tweezers experiments have investigated the unfolding of substrate's transmembrane domain, which is a prerequisite for the intramembrane cleavage reaction .

  • Inhibitor development: Building on the discovery of diisopropyl fluorophosphate as a covalent inhibitor for GlpG, researchers have developed peptidomimetics incorporating reactive phosphonate groups to prepare stable complexes with GlpG for structural analysis .

  • Substrate specificity determination: Mutagenesis and functional experiments have helped explain rhomboid's substrate specificity .

The mechanistic insights from these studies suggest that rhomboid proteases like glpG operate through a regulated intramembrane proteolysis mechanism that requires:

  • Initial substrate recognition and binding at an exosite

  • Conformational changes in both enzyme and substrate

  • Partial unfolding of the substrate's transmembrane domain

  • Presentation of the scissile bond to the catalytic serine-histidine dyad

These fundamental mechanisms likely apply to Salmonella agona Rhomboid protease glpG, though species-specific variations in substrate preference and regulation may exist.

What emerging technologies and approaches could advance research on Salmonella agona Rhomboid protease glpG?

Several cutting-edge technologies and approaches hold promise for deepening our understanding of Salmonella agona Rhomboid protease glpG:

  • Cryo-electron microscopy (Cryo-EM): This technique could provide high-resolution structures of glpG in its native lipid environment, potentially revealing conformational states not captured by crystallography.

  • Whole-genome sequencing (WGS): As demonstrated in studies of multidrug-resistant Salmonella enterica, WGS-based comparative genetic analyses help identify potential reservoirs of isolates or mobile genetic elements . This approach could reveal how glpG variants correlate with phenotypic differences across Salmonella strains.

  • CRISPR-Cas9 genome editing: Precise modification of glpG in Salmonella agona could help establish causative relationships between protease function and bacterial phenotypes.

  • Lipidomics and membrane biology: Since rhomboid proteases function within membranes, understanding how lipid composition affects their activity could provide new insights.

  • Computational approaches: Molecular dynamics simulations could help model substrate interactions and conformational changes in glpG that are difficult to capture experimentally.

  • Single-molecule techniques: Building on optical tweezers experiments mentioned in E. coli GlpG research , single-molecule approaches could reveal the dynamics of substrate processing by glpG.

How can researchers avoid common pitfalls in experimental design when studying Salmonella agona Rhomboid protease glpG?

Based on the challenges identified in genomic and protein research, researchers should be vigilant about:

  • Batch effects and confounding: According to Golden Helix's analysis, about 95% of studies had major problems with experimental design, particularly randomization issues . Researchers should:

    • Randomize sample processing order

    • Include cases and controls on the same plates/batches

    • Use technical replicates across batches

    • Employ statistical methods to identify and correct for batch effects

  • Protein stability and activity: Membrane proteins like glpG are particularly challenging because:

    • Detergent choice can affect structure and activity

    • Storage conditions impact stability (store in Tris-based buffer with 50% glycerol at -20°C or -80°C)

    • Avoid repeated freeze-thaw cycles, which can cause denaturation

  • Experimental controls: Include:

    • Catalytically inactive mutants (e.g., serine to alanine substitution in the active site)

    • Known substrates as positive controls

    • Non-substrate controls to verify specificity

  • Data interpretation: When combining multiple experiments for increased statistical power, be aware that confounding can worsen, potentially making it impossible to distinguish real associations from experimental artifacts .

The Wellcome Trust Case Control Consortium study serves as an important cautionary example - their genotyping of control populations on distinct sets of plates from disease studies introduced systematic biases that complicated data interpretation .

How does Salmonella agona Rhomboid protease glpG relate to rhomboid proteases in other clinically relevant pathogens?

Rhomboid proteases represent an ancient and widespread enzyme family that has acquired diverse biological functions during evolution . In the context of pathogens:

  • Malaria parasite (P. falciparum): Rhomboid proteases play an essential role in host cell invasion . While the mechanism differs from bacterial systems, understanding conserved features could inform broad-spectrum approaches to targeting these enzymes.

  • Other bacterial pathogens: Comparative genomic analyses of S. Agona isolates reveal variable resistance profiles, with most harboring resistance genes against only two classes (fosfomycin and efflux transporter subunits), while a minority carry resistance genes for nine or more drug classes . This diversity suggests different evolutionary pressures across bacterial lineages.

  • Persistence mechanisms: Recent studies of Salmonella Agona isolates from UK infections (2004-2020) identified genome rearrangements typically associated with early, convalescent carriage . These structural variations might reflect adaptations during the transition from acute to persistent infection, potentially involving regulatory changes in membrane protein processing pathways where glpG functions.

Evolutionary analyses suggest that while the catalytic mechanism of rhomboid proteases remains conserved, their substrate specificities and regulatory contexts have diversified substantially across species, allowing them to participate in varied biological processes from bacterial stress responses to parasite invasion of host cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.