Recombinant Salmonella agona Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Spermidine Export

MdtJ belongs to the small multidrug resistance (SMR) family and forms a complex with MdtI to export excess spermidine, mitigating cellular toxicity . Key findings include:

  • Mechanism: MdtJI complex activity is upregulated by spermidine, reducing intracellular spermidine levels by 50% in E. coli .

  • Critical Residues: Tyr⁴, Trp⁵, Glu¹⁵, and Tyr⁶¹ in MdtJ are essential for spermidine excretion .

  • Genetic Basis: Deletion of mdtJ or mdtI abolishes spermidine export, confirming their codependency .

3.1. Antimicrobial Resistance Studies

MdtJ’s role in spermidine transport links it to bacterial stress adaptation, though S. agona’s multidrug resistance is primarily plasmid-mediated (e.g., IncHI2 plasmids) . Notably, mdtJ is conserved in clinical S. agona isolates, suggesting evolutionary importance .

3.2. Vaccine Development

Recombinant MdtJ is used in immunological studies to develop Salmonella-targeted vaccines, leveraging its surface-exposed epitopes .

Comparative Genomic Insights

Phylogenomic studies of S. agona reveal:

  • Biofilm Regulation: Isolates from persistent infections show reduced biofilm formation, but mdtJ remains conserved across strains .

  • Metabolic Adaptations: Loss of 1,2-propanediol utilization in long-term carriers parallels host-restricted Salmonella evolution, though mdtJ’s role here is unconfirmed .

Future Directions

  • Functional Studies: Clarify MdtJ’s interaction with heavy metal resistance genes in S. agona .

  • Therapeutic Exploration: Target MdtJ in combination therapies to disrupt polyamine homeostasis in multidrug-resistant pathogens.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
mdtJ; SeAg_B1691; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEAARATI
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Salmonella agona MdtJ protein?

The MdtJ protein from Salmonella agona is a component of the MdtJI complex, which functions as a polyamine efflux pump belonging to the small multidrug resistance (SMR) family of transporters. Structurally, MdtJ consists of 121 amino acids organized into four transmembrane segments, with most of its functional amino acid residues facing the cytoplasm . This structural organization is similar to other polyamine excretion proteins such as PotE and CadB, suggesting a conserved mechanism for polyamine transport across bacterial species . The protein's amino acid sequence begins with MFYWILLALAIATEITGTLSMK as identified in recombinant protein studies .

The primary function of the MdtJI complex is to export spermidine and its precursor putrescine from the bacterial cytoplasm to the external environment. This export mechanism is particularly activated when polyamines accumulate to potentially toxic levels within the cell . Functionally, MdtJ works in conjunction with MdtI (109 amino acids) to form an effective transport complex that maintains polyamine homeostasis within the bacterial cell. The complex appears to serve as a "safety valve" that helps bacteria maintain optimal spermidine levels while preventing toxicity due to polyamine over-accumulation .

How is the mdtJI operon regulated in Salmonella and related bacterial species?

The mdtJI operon, encoding the MdtJ and MdtI proteins, is subject to complex regulatory mechanisms in Salmonella and related bacteria such as Shigella. Under normal physiological conditions, the mdtJI operon is expressed at very low levels, suggesting tight regulatory control . Research in Shigella has revealed several factors that influence mdtJI expression, which likely apply to Salmonella as well given the conservation of this system across related enterobacteria.

The expression of mdtJI is significantly increased by high intracellular levels of spermidine, suggesting an autoregulatory feedback mechanism where the substrate triggers expression of its own export system . In Shigella, the virulence regulator VirF has been shown to increase mdtJI expression, indicating integration of polyamine transport with virulence regulation pathways . Additionally, bile components stimulate mdtJI expression, which may be relevant in the intestinal environment where these bacteria typically reside . Studies in related bacteria have utilized various promoter fusion constructs (such as pJI lac-1, pJI lac-2, and pJI lac-3) to analyze the regulatory region of the mdtJI operon, revealing potential binding sites for regulatory factors .

Experimental approaches to study mdtJI regulation have included real-time PCR analysis with primers targeting the mdtJI transcript (using mJIf/mJIr primers) and the use of nusA as an endogenous control (with nusAF/nusAR primers) . These methodologies allow quantitative assessment of mdtJI expression under various environmental and genetic conditions.

What experimental systems are available for studying recombinant MdtJ protein?

Researchers interested in studying the Salmonella agona MdtJ protein have several experimental systems at their disposal. Recombinant MdtJ protein is commercially available for in vitro studies, typically provided in a Tris-based buffer with 50% glycerol for optimal stability . These preparations can be stored at -20°C or -80°C for extended periods, though repeated freezing and thawing should be avoided to maintain protein functionality .

For genetic studies, researchers have constructed various plasmid systems containing the mdtJI regulatory region or the entire operon. Examples include plasmids like pULS85 and pULS88, which have been created by cloning DNA fragments obtained through PCR amplification using specific primer pairs (such as mdF/mdR or JIF/JIR) with bacterial genomic DNA as template . These constructs allow for the manipulation and analysis of mdtJI expression in laboratory settings.

Reporter gene fusion systems, particularly lacZ fusions, have proven valuable for studying mdtJI regulation. Plasmids such as pJI lac-3, pJI lac-2, and pJI lac-1 contain different fragments of the mdtJI regulatory region fused to the lacZYA reporter system, enabling visual and quantitative assessment of gene expression under various conditions . These systems can be introduced into different bacterial backgrounds to evaluate the impact of genetic factors on mdtJI expression. Additionally, P1 transduction methods have been employed to transfer specific alleles between strains, facilitating genetic analysis of the mdtJI system .

What methods are used to measure MdtJ-mediated polyamine transport?

Measuring MdtJ-mediated polyamine transport requires specialized methodologies to accurately assess the movement of molecules like spermidine and putrescine across bacterial membranes. Researchers typically employ radioactive isotope-labeled polyamines to track their transport in and out of bacterial cells expressing the MdtJI complex. By comparing polyamine export rates between wild-type bacteria and those with mdtJI deletions or overexpression, the specific contribution of the MdtJI complex to polyamine efflux can be determined .

Growth assays in the presence of excess polyamines provide another approach to assess MdtJI function. Since polyamine over-accumulation can be toxic, bacteria with functional MdtJI systems typically show enhanced growth in high-polyamine environments compared to mutants lacking this transport system . This phenotypic difference can be quantified through standard growth curve measurements using optical density readings at 600nm (OD600).

For more precise quantification of gene expression levels, quantitative real-time PCR (qRT-PCR) is commonly employed to measure mdtJI transcript levels under various conditions. This technique utilizes specific primers targeting the mdtJI transcript and employs the 2^-ΔΔCt method for relative quantification, with housekeeping genes like nusA serving as endogenous controls . Environmental factors such as bile components (deoxycholate at 2.5-5 mg/ml or bile salts at 6-9 mg/ml) can be tested for their effects on mdtJI expression using these methods .

How does the experimental design for studying MdtJ function differ from standard transporter analyses?

The experimental design for studying MdtJ function presents unique challenges that differentiate it from standard transporter analyses, primarily due to the dual-protein nature of the MdtJI complex and its regulation by multiple factors. Unlike single-protein transporters, functional studies of MdtJ require consideration of its interaction with MdtI, as both proteins are necessary for proper efflux activity . This necessitates experimental designs that account for the expression levels of both components and their stoichiometric relationship.

For more complex experimental designs investigating multiple factors affecting MdtJ function simultaneously, Latin square or Graeco-Latin square designs may be employed . These designs are particularly useful when examining how factors such as spermidine concentration, bile components, and regulatory proteins interact to affect MdtJ activity. The statistical model for a Latin square design is yijk = μ + αi + τj + βk + εijk, allowing for the evaluation of row, column, and treatment effects .

Due to the low baseline expression of mdtJI under standard conditions, specialized induction systems may be necessary to achieve detectable protein levels for functional studies. This often requires careful optimization of expression conditions and sensitive detection methods that exceed those typically needed for constitutively expressed transporters.

What are the methodological challenges in analyzing MdtJ's role in polyamine homeostasis during bacterial infection?

Analyzing MdtJ's role in polyamine homeostasis during bacterial infection presents several methodological challenges that researchers must address through specialized experimental approaches. One primary challenge is the dynamic nature of the infection environment, where conditions such as pH, nutrient availability, and host defense mechanisms constantly change, potentially affecting MdtJ expression and function . To address this, researchers often employ tissue culture models that mimic specific aspects of infection, such as macrophage infection assays that replicate the intracellular environment experienced by Salmonella during infection.

The presence of host-derived polyamines complicates the assessment of bacterial polyamine export, making it difficult to distinguish between bacterial and host contributions to the polyamine pool. Researchers overcome this challenge by using isotope-labeled polyamines specifically in bacteria before infection, allowing tracking of bacterial polyamine export separate from host polyamines . Additionally, gene knockout approaches comparing wild-type and mdtJI-deficient strains in infection models can reveal the specific contribution of this transport system to bacterial survival and virulence.

Another significant challenge is the integration of the polyamine response with other stress responses during infection. MdtJI expression is affected by bile components and possibly other host-derived factors, requiring carefully designed experiments that can dissect these various influences . Experiments testing bacterial growth in media containing different concentrations of bile salts (6-9 mg/ml) or deoxycholate (2.5-5 mg/ml) can help determine how these environmental factors affect MdtJ function during infection .

Real-time monitoring of gene expression during infection presents technical difficulties, often addressed through reporter systems such as fluorescent proteins fused to the mdtJI promoter or through periodic sampling and qRT-PCR analysis. These approaches allow researchers to track the temporal dynamics of mdtJI expression throughout the infection process, though they may require relatively large sample sizes for statistical significance due to biological variability in infection models.

How can researchers effectively analyze the structure-function relationship of MdtJ using site-directed mutagenesis?

Site-directed mutagenesis represents a powerful approach for analyzing the structure-function relationship of the MdtJ protein, allowing researchers to systematically modify specific amino acid residues and assess their impact on protein function. Effective application of this technique to MdtJ requires careful planning based on comparative sequence analysis across bacterial species, identification of conserved domains, and prediction of functionally important residues, particularly those facing the cytoplasm as these have been identified as critical for function .

The experimental workflow typically begins with in silico analysis to identify candidate residues for mutagenesis. This involves multiple sequence alignment of MdtJ homologs across bacterial species, prediction of transmembrane domains, and identification of conserved motifs. Particular attention should be paid to the four transmembrane segments and the cytoplasm-facing residues, as these structural elements are likely crucial for polyamine recognition and transport . Once target residues are identified, site-directed mutagenesis can be performed using techniques such as PCR-based mutagenesis with specifically designed primers containing the desired mutations.

For functional analysis of mutant proteins, researchers typically employ complementation assays in mdtJI-knockout bacteria. Wild-type and mutant versions of mdtJ are introduced on plasmids into the knockout strain, and function is assessed through polyamine transport assays, growth in toxic polyamine concentrations, or resistance to antimicrobial compounds affected by the MdtJI system . The experimental design should include appropriate controls, such as vector-only and wild-type complementation, to ensure reliable interpretation of results.

Statistical analysis of the functional data follows standard approaches as outlined in experimental design literature, with effects of mutations compared to controls using appropriate statistical tests based on the experimental design employed (e.g., ANOVA followed by post-hoc tests) . The results can be organized into a structure-function map of MdtJ, highlighting residues critical for different aspects of function such as substrate binding, transport mechanism, or interaction with MdtI. This systematic approach allows researchers to develop a comprehensive understanding of how MdtJ's structure enables its role in polyamine efflux.

What experimental approaches can determine if MdtJ interacts with other cellular components beyond MdtI?

Determining whether MdtJ interacts with cellular components beyond its known partner MdtI requires sophisticated protein interaction studies coupled with functional validation approaches. Co-immunoprecipitation (Co-IP) represents a primary method for identifying protein-protein interactions involving MdtJ. This approach typically involves creating tagged versions of MdtJ (such as the FLAG-tag system used for VirF in related studies) , expressing these in Salmonella, lysing the cells under conditions that preserve protein-protein interactions, and then using antibodies against the tag to precipitate MdtJ along with any interacting partners. The precipitated proteins can be identified through mass spectrometry, revealing potential interaction partners.

Bacterial two-hybrid systems offer an alternative approach for screening potential MdtJ interaction partners. In this method, MdtJ is fused to one domain of a split transcription factor, while a library of bacterial proteins is fused to the complementary domain. Interaction between MdtJ and a partner protein brings the two domains together, activating reporter gene expression that can be detected and quantified. This approach allows for systematic screening of the bacterial proteome for potential MdtJ interactors.

Cross-linking studies combined with mass spectrometry provide another powerful tool for identifying transient or weak interactions that might be missed by other methods. Chemical cross-linkers can be used to stabilize protein-protein interactions in living bacteria before cell lysis, increasing the likelihood of detecting physiologically relevant but potentially unstable interactions. This approach is particularly valuable for membrane proteins like MdtJ that operate in complex lipid environments.

Functional validation of identified interactions can be performed through genetic approaches, such as creating knockout strains for potential interaction partners and assessing the impact on MdtJ function. Additionally, site-directed mutagenesis targeting predicted interaction interfaces can provide evidence for the functional significance of identified interactions. The results can be statistically analyzed using appropriate models, such as the randomized complete block design, to account for variables that might influence interaction detection .

Comparative Analysis of MdtJ Structure and Function Across Bacterial Species

Understanding the conservation and variation of MdtJ across bacterial species provides valuable insights into its evolutionary significance and functional constraints. Based on available research data, the following table presents a comparative analysis of MdtJ characteristics across relevant bacterial species:

Bacterial SpeciesMdtJ Size (amino acids)Transmembrane SegmentsKey Functional ResiduesPolyamine Substrate SpecificityReference
Salmonella agona1214Cytoplasm-facingSpermidine, Putrescine
Shigella flexneri1214Cytoplasm-facingSpermidine, Putrescine
E. coli1214Cytoplasm-facingSpermidine (after 24h accumulation)

For researchers investigating MdtJ function across bacterial species, experimental approaches should account for these similarities and differences. Complementation experiments, where the mdtJ gene from one species is expressed in an mdtJ-knockout strain of another species, can reveal the functional conservation and species-specific adaptations. These experiments should be designed following statistical principles such as the randomized complete block design to control for variables like expression levels and genetic background .

Experimental Design for Analyzing mdtJI Regulation Under Different Conditions

The regulation of mdtJI expression involves multiple factors including polyamine levels, virulence regulators, and environmental conditions. A comprehensive experimental design for analyzing this regulation should incorporate these variables in a systematic manner. The following table outlines a factorial experimental design approach:

ConditionSpermidine ConcentrationBile ComponentsVirF ExpressionExpected mdtJI ExpressionExperimental Method
ControlBasal (0.5 mM)NoneNormalLowqRT-PCR
High Spermidine5 mMNoneNormalIncreasedqRT-PCR
Bile ExposureBasal (0.5 mM)6 mg/ml bile saltsNormalIncreasedqRT-PCR
VirF OverexpressionBasal (0.5 mM)NoneOverexpressedIncreasedqRT-PCR
Combined Stimuli5 mM6 mg/ml bile saltsOverexpressedHighly IncreasedqRT-PCR

This factorial design allows for the assessment of individual factors and their interactions in regulating mdtJI expression. Quantitative real-time PCR using primers targeting the mdtJI transcript (mJIf/mJIr) with nusA as an endogenous control (nusAF/nusAR) provides a reliable method for measuring expression levels . The experimental results can be analyzed using statistical approaches appropriate for factorial designs, such as ANOVA with interaction terms, to determine the significance of each factor and potential synergistic effects .

For more detailed analysis of promoter regulation, reporter gene fusion experiments using constructs like pJI lac-1, pJI lac-2, and pJI lac-3 can be employed to identify specific regulatory regions responsible for responses to different stimuli . These experiments should be designed with appropriate replication and controls to ensure statistical validity according to established experimental design principles .

Methodological Framework for Studying MdtJ Function in Infection Models

Studying MdtJ function during infection requires integration of molecular, cellular, and in vivo approaches. The following table presents a methodological framework for comprehensive analysis of MdtJ's role in infection:

Research QuestionExperimental SystemMethodologyKey MeasurementsData Analysis Approach
MdtJ expression during infectionMacrophage infection modelInfection with reporter strainsFluorescence/β-galactosidase activityTime-course analysis, statistical comparison between strains
Impact on bacterial survivalCompetitive infection (WT vs. ΔmdtJI)Infection of cell cultures or animal modelsCompetitive index calculationStatistical significance testing
Polyamine dynamicsIsotope-labeled polyamine tracingPre-loading bacteria with labeled polyamines before infectionMeasurement of labeled polyamine exportKinetic modeling of export rates
Host response to MdtJ activityTranscriptomics/proteomicsInfection with WT vs. ΔmdtJI strainsDifferential gene/protein expressionPathway analysis, enrichment testing

This methodological framework provides a comprehensive approach to understanding MdtJ function in the context of infection. The experimental design for each component should follow appropriate statistical models, such as randomized complete block design or Latin square design depending on the specific variables being controlled . By integrating data from these complementary approaches, researchers can develop a comprehensive understanding of how MdtJ contributes to bacterial adaptation during infection and potentially identify new targets for antimicrobial intervention.

How should researchers optimize expression and purification of recombinant MdtJ for structural studies?

Optimizing expression and purification of recombinant MdtJ presents significant challenges due to its hydrophobic nature as a membrane protein with four transmembrane segments . Researchers should begin by selecting appropriate expression systems that can accommodate membrane proteins, with E. coli BL21(DE3) strains carrying specialized vectors designed for membrane protein expression being common choices. The expression vector should include affinity tags (such as His6 or FLAG) positioned to avoid interference with protein folding, typically at the C-terminus as suggested by successful protein characterization studies .

Expression conditions require careful optimization, with lower temperatures (16-20°C) often yielding better results for membrane proteins by allowing proper folding and membrane insertion. Induction protocols typically employ reduced IPTG concentrations (0.1-0.5 mM) and extended expression periods (16-24 hours) to minimize the formation of inclusion bodies. The addition of specific membrane-stabilizing additives such as glycerol (5-10%) to the culture medium can further enhance proper folding and membrane integration.

For purification, a multi-step approach is necessary to obtain pure, functional MdtJ protein. Initial solubilization of membranes should employ mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) that maintain protein structure and function. Affinity chromatography using the incorporated tags provides initial purification, followed by size exclusion chromatography to separate properly folded MdtJ from aggregates and other impurities. Throughout the purification process, maintaining a stable buffer system containing appropriate detergents, glycerol (typically 50% for storage), and stabilizing agents is crucial for preserving protein activity .

Quality control of the purified protein should include SDS-PAGE analysis, western blotting, mass spectrometry verification, and functional assays to confirm that the purified MdtJ retains its native structure and activity. For structural studies such as X-ray crystallography or cryo-electron microscopy, additional considerations include achieving high concentration and purity while maintaining protein stability, often requiring screening of various buffer conditions and potentially the use of lipid nanodiscs or other membrane-mimetic systems.

What statistical approaches are most appropriate for analyzing MdtJ function in diverse experimental systems?

For more complex experiments investigating multiple factors affecting MdtJ function, factorial designs analyzed through multifactor ANOVA are more appropriate. When examining three or more factors, Latin square or Graeco-Latin square designs may be employed, with statistical models such as yijk = μ + αi + τj + βk + εijk for Latin square designs . These approaches allow for efficient estimation of main effects while controlling for multiple sources of variation.

Time-course experiments monitoring MdtJ-mediated polyamine export require specialized statistical approaches for longitudinal data. Mixed-effects models that account for repeated measurements and potential correlation structures are particularly suitable for these analyses. These models can incorporate fixed effects (e.g., strain, treatment) and random effects (e.g., biological replicate) while appropriately handling the time-dependent nature of the data.

For all statistical analyses, researchers should ensure adequate replication (typically at least three biological replicates) and appropriate randomization to minimize bias. Reporting of results should include not just p-values but also effect sizes, confidence intervals, and clear descriptions of the statistical models employed. When comparing multiple conditions, appropriate corrections for multiple testing (e.g., Bonferroni, Benjamini-Hochberg) should be applied to control the family-wise error rate or false discovery rate.

How can researchers effectively isolate and analyze the specific contribution of MdtJ in mixed bacterial populations?

Isolating and analyzing the specific contribution of MdtJ in mixed bacterial populations presents unique challenges that require specialized experimental approaches. Competitive fitness assays represent a powerful method for this purpose, where wild-type and mdtJI-deficient strains are differentially marked (e.g., with different fluorescent proteins or antibiotic resistance markers), mixed in equal proportions, and then grown under conditions where MdtJ function may provide a selective advantage. The relative abundance of each strain can be tracked over time through selective plating, flow cytometry, or quantitative PCR, providing a direct measure of the fitness contribution of MdtJ under the tested conditions.

For more precise molecular analysis, researchers can employ strain-specific genetic markers coupled with selective enrichment techniques. By introducing unique nucleotide sequences (barcodes) into the genomes of different strains in a mixed population, researchers can use high-throughput sequencing to quantify the relative abundance of each strain with high precision. This approach is particularly valuable for tracking subtle fitness differences that might not be apparent in traditional competitive assays.

Transcriptional reporter systems offer another approach for analyzing MdtJ activity in mixed populations. By integrating fluorescent protein genes under the control of the mdtJI promoter in specific bacterial strains, researchers can use fluorescence microscopy or flow cytometry to specifically track mdtJI expression in those strains within mixed populations. This approach allows for real-time monitoring of gene expression dynamics in complex communities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.