Recombinant Salmonella agona Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are collected at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; SeAg_B3569; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
msrQ
Target Protein Sequence
MRLTAKQITWLKVCLHLAGFLPLLWLFWAINHGGLSADPVKDIQHFTGRTALKFLLATLL VSPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTL GIISWLVLLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPIHYLWSVKILSPQPVIYA ALALALLALRYRKFRQWWR
Uniprot No.

Target Background

Function
YedZ is a part of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This process safeguards these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by host defense mechanisms. The MsrPQ system is essential for maintaining envelope integrity under bleach stress, rescuing a wide range of structurally unrelated periplasmic proteins from methionine oxidation. This includes the primary periplasmic chaperone SurA and the lipoprotein Pal. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YedZ in Salmonella agona metabolism?

YedZ functions as a sulfoxide reductase heme-binding subunit in Salmonella agona, playing a critical role in electron transport chains involved in sulfoxide reduction. The protein participates in cellular respiration processes by catalyzing the reduction of various sulfoxide compounds, thereby contributing to the bacterium's metabolic versatility.

As a flavocytochrome, YedZ contains both a heme group and flavin cofactor, enabling it to shuttle electrons during redox reactions. This activity is particularly important for Salmonella's survival in oxygen-limited environments and may contribute to the pathogen's ability to adapt to various host environments. Unlike many virulence factors, YedZ is primarily involved in basic metabolic function rather than direct pathogenicity mechanisms .

How does YedZ relate to other proteins in the sulfoxide reductase family?

YedZ belongs to the broader family of sulfoxide reductases but represents a specialized subclass of heme-binding components. Comparative analysis with homologous proteins from other bacterial species reveals:

OrganismProteinIdentity to S. agona YedZKey Structural Differences
E. coliYedZ~92%Minor differences in transmembrane domains
Salmonella entericaYedZ~97%Nearly identical structure
Klebsiella pneumoniaeYedZ homolog~85%Variations in the N-terminal region
Yersinia speciesYedZ-like protein~75%Different heme coordination chemistry

The YedZ protein typically functions in conjunction with YedY, a molybdoenzyme that forms the catalytic component of the sulfoxide reductase system. Together, they form a functional complex that efficiently processes sulfoxide substrates through complementary electron transfer mechanisms .

What are the current challenges in expressing recombinant YedZ for structural studies?

Expressing recombinant YedZ presents several significant challenges for structural studies:

  • Membrane protein solubility: As a membrane-associated protein, YedZ is highly hydrophobic, making it difficult to express and purify in sufficient quantities for crystallographic or NMR studies. Researchers must carefully optimize detergent types and concentrations to maintain protein solubility without disrupting native structure.

  • Heme incorporation: Proper folding of YedZ requires correct insertion of the heme prosthetic group. Expression systems often struggle with efficient heme incorporation, leading to heterogeneous protein preparations with varying degrees of heme saturation.

  • Protein stability: The recombinant YedZ protein shows considerable instability during purification processes, with significant activity loss observed during extended handling. Current protocols recommend maintaining the protein at -20°C in 50% glycerol buffer for short-term storage, and at -80°C for extended storage, with minimal freeze-thaw cycles to preserve activity .

  • Expression system selection: While E. coli expression systems are commonly used, they often produce YedZ with incomplete post-translational modifications. Alternative expression systems may provide better results but require extensive optimization.

How does the antimicrobial resistance profile of Salmonella agona affect YedZ function and expression?

The relationship between antimicrobial resistance (AMR) and YedZ function represents an emerging area of research. Recent studies of multidrug-resistant (MDR) Salmonella agona isolates have revealed several intriguing connections:

  • Plasmid-mediated effects: MDR Salmonella agona isolates, such as the 18-SA00377 strain isolated from dietary supplements in Germany, carry large plasmids containing numerous antibiotic resistance genes (ARGs). These plasmids can potentially affect the expression of chromosomal genes, including yedZ, through global regulatory mechanisms .

  • Metabolic adaptation: The acquisition of resistance to multiple antibiotics often requires metabolic reprogramming in bacteria. As YedZ participates in electron transport processes, its expression and activity may be modulated as part of this adaptation.

  • Metal homeostasis interference: Many MDR isolates simultaneously carry genes for heavy metal resistance. For instance, the 18-SA00377 isolate harbors resistance genes for six different heavy metals. Since YedZ is a metalloprotein containing heme, alterations in metal homeostasis could affect its assembly and function .

  • Stress response effects: The presence of antibiotics and associated stress responses may alter the expression profile of numerous genes, including those involved in respiratory functions like YedZ.

Research examining the transcriptomic profiles of MDR versus susceptible Salmonella agona isolates has shown differential expression of multiple metabolic genes, suggesting that resistance acquisition may indeed influence YedZ expression patterns through global regulatory networks .

What is the role of YedZ in Salmonella agona virulence and host-pathogen interactions?

While YedZ is primarily characterized as a metabolic enzyme rather than a classical virulence factor, emerging research suggests potential indirect contributions to Salmonella agona pathogenicity:

  • Oxidative stress resistance: YedZ may help Salmonella agona counter oxidative stress encountered during host immune responses by reducing toxic sulfoxides generated during infection.

  • Intracellular survival: The ability of Salmonella to persist within host cells depends partly on metabolic adaptation to the intracellular environment. YedZ-mediated electron transport processes may contribute to this adaptation.

  • Biofilm formation: Some research indicates that alterations in redox enzymes like YedZ can influence biofilm formation capabilities, potentially affecting Salmonella persistence on surfaces.

  • Interaction with host sulfur metabolism: YedZ may participate in modifying host-derived sulfur compounds, potentially altering the infection microenvironment.

What are the optimal conditions for expressing and purifying recombinant YedZ protein?

Successful expression and purification of recombinant YedZ requires careful optimization of multiple parameters:

Expression System Recommendations:

Optimized Protocol Elements:

  • Vector selection: pET vectors with tightly controlled induction systems are recommended, particularly those with fusion tags that enhance solubility (MBP or SUMO tags often perform better than His-tags alone).

  • Induction conditions: Low-temperature induction (16-18°C) with reduced IPTG concentration (0.1-0.3 mM) over extended periods (16-24 hours) maximizes properly folded protein yield.

  • Membrane extraction: Gentle lysis using specialized detergents (n-dodecyl β-D-maltoside at 1-2% has shown good results) is critical for maintaining protein structure.

  • Purification strategy: A two-step purification approach is recommended:

    • Initial immobilized metal affinity chromatography (IMAC)

    • Followed by size exclusion chromatography

  • Buffer optimization: Purification buffers should contain:

    • 20-50 mM Tris-HCl (pH 7.5-8.0)

    • 100-300 mM NaCl

    • 0.05-0.1% mild detergent

    • 5-10% glycerol for stability

    • 1-5 mM reducing agent (DTT or β-mercaptoethanol)

  • Storage conditions: For optimal stability, store purified YedZ in Tris-based buffer with 50% glycerol at -20°C for short-term use, or at -80°C for extended storage. Minimize freeze-thaw cycles as repeated freezing and thawing significantly reduces activity .

What analytical methods are most effective for assessing YedZ enzymatic activity?

Several complementary analytical methods provide comprehensive assessment of YedZ enzymatic activity:

Spectrophotometric Assays:

  • Cytochrome c reduction assay: Monitors electron transfer from YedZ to cytochrome c at 550 nm, providing a real-time measure of enzymatic activity.

  • NADH oxidation coupling: Measures NADH consumption (decrease in absorbance at 340 nm) when coupled to YedZ activity through appropriate electron donors.

  • Specific substrate reduction: Monitors the reduction of model sulfoxide substrates (like methionine sulfoxide or DMSO) through either direct spectrophotometric detection or coupled assay systems.

Direct Product Analysis:

  • HPLC-based methods: Separation and quantification of substrate and product compounds to directly measure conversion rates.

  • Mass spectrometry: Provides precise quantification of substrate depletion and product formation, especially useful for complex or novel substrates.

Protein-Specific Analytical Techniques:

  • UV-visible spectroscopy: Characterization of the heme prosthetic group through its characteristic absorption spectrum (Soret band at ~410 nm and α/β bands at ~530-560 nm).

  • Electron paramagnetic resonance (EPR): Assessment of the redox state of the heme iron center.

  • Protein film voltammetry: Direct measurement of electron transfer properties and redox potentials.

Each method has specific advantages and limitations. A comprehensive characterization typically employs multiple complementary techniques to provide a complete picture of YedZ enzymatic properties and substrate specificity .

How can researchers effectively use recombinant YedZ in antibody production and immunological studies?

Generating high-quality antibodies against YedZ requires careful consideration of its membrane protein nature and heme-binding properties:

Antigen Preparation Strategies:

  • Full-length versus partial antigens:

    • Full-length YedZ is challenging due to its hydrophobicity

    • Hydrophilic domains or synthetic peptides corresponding to exposed regions (especially amino acids 35-55 and 160-180) often yield better antibodies

  • Fusion protein approaches:

    • KLH-conjugated peptides significantly enhance immunogenicity

    • GST or MBP fusion constructs maintain solubility while preserving epitope accessibility

Immunization Protocols:

Animal ModelAdvantagesRecommended ProtocolExpected Titer
RabbitsHigh-volume antisera4-5 injections over 10 weeks1:10,000 - 1:50,000
MiceMonoclonal developmentInitial injection + 3 boostsVariable
ChickensIgY production in eggs4 injections over 8 weeks1:5,000 - 1:20,000

Antibody Validation Methods:

  • Western blotting: Confirms specificity against recombinant and native YedZ, with expected band at approximately 22 kDa

  • Immunoprecipitation: Assesses ability to capture the native protein from bacterial lysates

  • Immunohistochemistry/Immunofluorescence: Evaluates antibody performance in localization studies (typically showing membrane distribution pattern)

  • Cross-reactivity testing: Determines specificity by testing against YedZ homologs from related species

Applications in Research:

  • The validated antibodies can be effectively used for:

    • Tracking protein expression under different growth conditions

    • Studying protein-protein interactions through co-immunoprecipitation

    • Examining subcellular localization

    • Developing diagnostic assays for Salmonella detection

  • When designing immunological studies, researchers should be aware that the membrane-associated nature of YedZ may require specialized fixation and permeabilization protocols to maintain epitope accessibility while preserving membrane structure .

How should researchers design experiments to study YedZ function in the context of Salmonella pathogenesis?

Designing robust experiments to investigate YedZ's role in Salmonella pathogenesis requires a multi-faceted approach:

Genetic Manipulation Strategies:

  • Gene knockout/knockdown approaches:

    • Clean deletion of yedZ using lambda Red recombination

    • Conditional expression systems (tetracycline-regulated promoters)

    • CRISPR-Cas9 mediated mutagenesis for precise genomic alterations

  • Complementation controls:

    • Trans-complementation with wild-type yedZ

    • Site-directed mutants affecting key functional residues

    • Heterologous expression of YedZ homologs from other species

Infection Model Selection:

Model SystemAdvantagesLimitationsKey Parameters to Measure
Cell culture modelsControlled conditions, high-throughputLimited complexityInvasion, intracellular survival, cytokine response
Galleria mellonellaEthical advantages, cost-effectiveEvolutionary distanceSurvival rates, bacterial burden
Mouse modelsMammalian physiology, immune systemEthical considerations, costColonization, organ burden, inflammatory markers

Experimental Controls and Variables:

  • Essential controls:

    • Wild-type Salmonella agona strain (positive control)

    • Known attenuated strain (e.g., SPI-1 mutant) as reference

    • Complemented yedZ mutant to confirm phenotype specificity

  • Critical experimental variables:

    • Growth conditions prior to infection (aerobic vs. anaerobic)

    • MOI for in vitro infections

    • Sampling timepoints (early vs. late infection)

    • Stress conditions (oxidative, nitrosative, pH, etc.)

  • Randomization and blinding:

    • Randomize experimental units to prevent bias

    • Blind analysis of endpoints where possible

    • Include biological and technical replicates

When designing these experiments, it's crucial to recognize that as a metabolic protein, YedZ effects may be subtle and context-dependent. Researchers should consider multiple experimental conditions, particularly those that might stress electron transport systems or create environments where sulfoxide metabolism becomes advantageous .

What are the best approaches for comparing YedZ function across different Salmonella serovars?

Comparing YedZ function across Salmonella serovars requires careful experimental design to ensure valid comparisons while accounting for genomic and physiological differences:

Standardized Analytical Framework:

  • Sequence and structure analysis:

    • Multiple sequence alignment of yedZ genes and predicted proteins

    • Structural modeling to identify conserved domains and variant regions

    • Phylogenetic analysis to establish evolutionary relationships

  • Expression profiling:

    • RT-qPCR under standardized conditions

    • Proteomic analysis to quantify protein levels

    • Western blotting with serovar-cross-reactive antibodies

  • Functional characterization:

    • Enzymatic activity assays with common substrates

    • Growth phenotyping under selective conditions

    • Complementation studies in a common genetic background

Comparative Experimental Design:

The experimental design must eliminate potential confounding variables. One effective approach is to use a Latin square design where multiple researchers ("operators") test multiple models (serovars) across multiple conditions, as this helps eliminate operator bias while providing robust replication .

OperatorTest Round 1Test Round 2Test Round 3
Operator 1Serovar ASerovar BSerovar C
Operator 2Serovar BSerovar CSerovar A
Operator 3Serovar CSerovar ASerovar B

This design ensures that any observed differences are due to true biological variation rather than experimental handling or operator bias .

Data Integration Approaches:

To properly interpret comparative data across serovars, researchers should:

  • Normalize functional data against appropriate housekeeping genes/proteins

  • Account for genomic context differences (e.g., neighboring genes, regulatory elements)

  • Consider evolutionary relationships when interpreting functional differences

  • Apply appropriate statistical analyses for multiple comparisons

When studying multidrug-resistant isolates like 18-SA00377, researchers should also consider how acquired resistance determinants might influence YedZ expression or function, either directly or through global regulatory changes .

How can researchers effectively design competition experiments to assess the fitness contribution of YedZ?

Competition experiments provide powerful insights into the fitness contribution of YedZ under different environmental conditions. Effective design includes:

Competition Assay Design Elements:

  • Strain construction and validation:

    • Create isogenic strains differing only in yedZ status

    • Incorporate distinct neutral markers (different fluorescent proteins or antibiotic resistance markers)

    • Validate that markers do not themselves affect fitness

  • Competition ratio optimization:

    • Start with 1:1, but also test asymmetric ratios (1:10, 10:1)

    • Perform preliminary experiments to determine appropriate duration

    • Establish sampling intervals that capture population dynamics

  • Environmental condition selection:

    • Standard laboratory media (LB, minimal media)

    • Host-mimicking conditions (low pH, high osmolarity)

    • Oxidative stress conditions

    • Nutrient limitation scenarios

    • Presence of antimicrobial compounds

Quantification Methodologies:

MethodAdvantagesLimitationsDetection Range
Selective platingSimple, accessibleLabor-intensive10²-10⁹ CFU/ml
Flow cytometryRapid, single-cell resolutionRequires fluorescent markers10³-10⁷ cells/ml
qPCRHighly sensitiveDetects DNA from dead cells10¹-10⁸ copies/ml
Barcode sequencingHigh-throughput, multiple strainsComplex analysis, specialized equipment10²-10⁹ cells/ml

Data Analysis Approaches:

  • Calculation of competition index (CI):
    CI = (mutant output/wild-type output)/(mutant input/wild-type input)

  • Fitness cost estimation:

    • Determine selection coefficient (s) across multiple generations

    • Calculate relative fitness (w) = 1 - s

  • Statistical analysis:

    • ANOVA for multi-condition comparisons

    • Appropriate post-hoc tests for specific comparisons

    • Non-parametric alternatives when assumptions are not met

  • Modeling approaches:

    • Use differential equation models to estimate growth parameters

    • Apply Bayesian methods to quantify uncertainty

When analyzing competition data, ensure that experiments run for sufficient generations to detect subtle fitness effects, as metabolic genes like yedZ may confer small but significant advantages under specific conditions. Additionally, include appropriate controls, such as competitions between wild-type strains with different markers, to account for any marker-specific effects .

How should researchers interpret contradictory findings regarding YedZ function in different experimental systems?

Contradictory findings regarding YedZ function are not uncommon in the literature and require careful analysis:

Sources of Experimental Variability:

  • Strain differences: Even within Salmonella agona, natural variation exists in YedZ sequence and regulation. Experiments using reference strain SL483 may yield different results than those using clinical or environmental isolates .

  • Experimental conditions: YedZ function is highly context-dependent, with differential effects observed under:

    • Varying oxygen tensions

    • Different growth phases

    • Presence of specific electron donors/acceptors

    • pH variations

  • Methodological differences: Variations in:

    • Protein purification techniques

    • Activity assay components

    • Data normalization approaches

Systematic Approach to Resolving Contradictions:

  • Direct replication attempts:

    • Reproduce key experiments using identical protocols

    • If possible, exchange materials between laboratories

    • Document all parameters, including reagent sources and lot numbers

  • Parameter space exploration:

    • Systematically vary experimental conditions

    • Identify boundary conditions where results transition

    • Develop predictive models of condition-dependent behavior

  • Integration with complementary techniques:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Apply structural biology approaches to explain functional differences

    • Use computational modeling to predict condition-dependent behavior

Framework for Data Integration:

When faced with contradictory findings, researchers should apply experimental design principles to identify operator effects, watershed effects (different experimental systems), and true biological variation . Applying randomization and replication across multiple operators and experimental systems can help disentangle these factors.

The goal should be to develop a unified model that explains when and why YedZ functions differently under varied conditions, rather than simply declaring one set of results "correct" and others "incorrect."

What statistical approaches are most appropriate for analyzing YedZ expression data across different environmental conditions?

Analyzing YedZ expression data requires statistical approaches that account for the complexity of biological systems and experimental designs:

Preprocessing Considerations:

  • Data normalization options:

    • Global normalization (total counts, median normalization)

    • Reference gene normalization (using validated stable references)

    • Spike-in controls for absolute quantification

  • Quality control metrics:

    • Assessment of technical and biological variation

    • Identification and handling of outliers

    • Evaluation of normality and homoscedasticity

Statistical Analysis Approaches:

Analysis MethodAppropriate Use CaseKey AssumptionsAdvantages
t-tests/ANOVATwo or more distinct conditionsNormality, equal varianceSimple, widely understood
Linear mixed modelsNested designs, repeated measuresProper specification of random effectsHandles complex designs
MANOVAMultiple dependent variablesMultivariate normalityAccounts for correlations between measures
Non-parametric testsNon-normal dataFew assumptionsRobust to outliers
Time series analysisTemporal expression patternsAppropriate correlation structureCaptures dynamic behavior

Multiple Testing Considerations:

When analyzing YedZ expression across numerous conditions or timepoints:

  • Apply appropriate multiple testing corrections (Bonferroni, Benjamini-Hochberg)

  • Consider false discovery rate (FDR) control rather than family-wise error rate

  • Use q-values rather than p-values for large-scale comparisons

Advanced Analytical Approaches:

  • Multivariate analysis:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Hierarchical clustering to identify condition groupings

    • Partial Least Squares (PLS) to correlate expression with functional outcomes

  • Machine learning approaches:

    • Random forests for identifying key predictive variables

    • Support vector machines for condition classification

    • Neural networks for complex pattern recognition

When analyzing expression data from multidrug-resistant isolates like 18-SA00377, researchers should consider the potential influence of plasmid-borne resistance determinants and regulatory elements on chromosomal gene expression patterns .

How can researchers effectively integrate structural, functional, and genetic data to build comprehensive models of YedZ activity?

Building comprehensive models of YedZ activity requires integration of multiple data types through a structured approach:

Data Integration Framework:

Computational Modeling Approaches:

  • Structural bioinformatics:

    • Molecular docking of substrates

    • Quantum mechanical modeling of the heme center

    • Molecular dynamics simulations under varying conditions

    • Protein-protein interaction prediction

  • Systems biology approaches:

    • Metabolic network modeling

    • Flux balance analysis incorporating YedZ activity

    • Kinetic modeling of electron transfer pathways

    • Gene regulatory network reconstruction

  • Evolutionary analysis:

    • Phylogenetic profiling across bacterial species

    • Selection pressure analysis on different protein domains

    • Co-evolution analysis with interaction partners

    • Horizontal gene transfer assessment

Validation and Refinement Strategies:

  • Iterative model building:

    • Start with core conserved features

    • Progressively incorporate variable elements

    • Validate predictions experimentally

    • Refine model based on new data

  • Critical hypothesis testing:

    • Generate testable predictions from the model

    • Design experiments specifically to challenge model assumptions

    • Incorporate negative results to refine model boundaries

  • Model sharing and community refinement:

    • Deposit structural models in public databases

    • Publish detailed methodology for reproducibility

    • Engage multiple research groups for collaborative validation

By systematically integrating these diverse data types, researchers can build models that explain YedZ activity in different contexts, including its potential contributions to Salmonella agona metabolism, stress responses, and possibly pathogenesis in multidrug-resistant strains like 18-SA00377 .

What are the potential applications of YedZ research in developing new antimicrobial strategies?

YedZ research offers several promising avenues for novel antimicrobial strategy development:

Therapeutic Target Potential:

  • Structure-based drug design:

    • The unique heme-binding pocket of YedZ presents opportunities for selective inhibitor development

    • Compounds targeting the electron transfer function could disrupt bacterial metabolism

    • Virtual screening approaches can identify candidates from existing chemical libraries

  • Metabolic vulnerability exploitation:

    • If YedZ contributes to survival under specific host conditions, combination therapies could target both YedZ and alternate metabolic pathways

    • Adjuvants that increase reliance on YedZ-dependent pathways could enhance efficacy of existing antibiotics

  • Anti-virulence approach:

    • While not a classical virulence factor, disrupting YedZ function might attenuate Salmonella without creating strong selection pressure for resistance

Considerations for MDR Salmonella:

The rise of multidrug-resistant Salmonella agona isolates, like 18-SA00377 with resistance to 12 different antibiotic classes, underscores the need for novel targets . YedZ represents a potential target with several advantages:

  • It is not targeted by current antibiotics, avoiding existing resistance mechanisms

  • As a membrane protein with essential functions, resistance development may be constrained

  • Limited homology to human proteins may reduce off-target effects

Challenges and Research Priorities:

  • Target validation requirements:

    • Comprehensive assessment of YedZ essentiality across conditions

    • Determination of minimal inhibitory levels for function

    • Evaluation of compensatory mechanisms

  • Technical hurdles:

    • Membrane protein targets are challenging for traditional drug discovery pipelines

    • Assay development for high-throughput screening

    • Optimization of compound membrane permeability

  • Resistance development assessment:

    • Potential for target mutation

    • Alternative pathway activation

    • Efflux pump-mediated resistance

Research into YedZ as an antimicrobial target should be pursued alongside investigations of other novel targets, with particular attention to combination strategies that might address the multidrug resistance challenges posed by isolates like 18-SA00377 .

How might YedZ function differ between antibiotic-susceptible and multidrug-resistant Salmonella agona strains?

The functional differences in YedZ between antibiotic-susceptible and multidrug-resistant (MDR) Salmonella agona strains represent an important but understudied area:

Potential Mechanisms of Differential Function:

  • Expression level variations:

    • MDR strains often exhibit altered global gene regulation

    • Stress responses associated with antibiotic resistance may indirectly affect yedZ expression

    • Plasmid-encoded regulators in MDR strains like 18-SA00377 may influence chromosomal gene expression

  • Protein sequence variations:

    • MDR strains may harbor mutations in yedZ that affect function

    • These changes might be compensatory adaptations to fitness costs of resistance

    • Altered substrate specificity could result from these mutations

  • Post-translational modifications:

    • Changes in cellular physiology in MDR strains may affect protein processing

    • Altered heme biosynthesis or incorporation could impact YedZ activity

    • Membrane composition differences may affect protein localization and function

Research Evidence and Knowledge Gaps:

Comparative genomic analysis of MDR Salmonella agona isolates, including 18-SA00377 and similar strains, has revealed considerable genetic diversity . While core genome functions are largely conserved, regulatory networks often show significant variation. Limited data suggests that:

  • Some MDR Salmonella isolates show altered expression of electron transport components

  • Plasmid-encoded resistance determinants may impose metabolic burdens that affect central metabolism

  • Adaptation to antibiotics can select for compensatory mutations in metabolic pathways

Research Approaches to Address Knowledge Gaps:

  • Comparative transcriptomics/proteomics:

    • RNA-Seq and quantitative proteomics comparing yedZ expression

    • Analysis of co-expressed genes to identify regulatory differences

    • Assessment of expression under antibiotic stress conditions

  • Functional comparisons:

    • Enzymatic activity assays with purified YedZ from different strains

    • Growth phenotyping under conditions requiring YedZ function

    • Cross-complementation studies between susceptible and MDR strains

  • Structural biology approaches:

    • Comparative structural analysis of YedZ variants

    • Assessment of heme incorporation efficiency

    • Substrate binding and catalytic efficiency comparisons

Understanding these differences could provide insights into both resistance mechanisms and potential compensatory adaptations in MDR Salmonella agona strains .

What emerging technologies could advance YedZ research in the next decade?

Several cutting-edge technologies are poised to significantly advance YedZ research in the coming decade:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution of membrane proteins without crystallization

    • Visualization of YedZ in different functional states

    • Structural characterization of protein complexes involving YedZ

  • Integrative structural biology:

    • Combining multiple techniques (X-ray, NMR, SAXS, cryo-EM)

    • Computational modeling to fill structural knowledge gaps

    • Time-resolved structural studies to capture dynamic processes

  • AlphaFold and related AI approaches:

    • Highly accurate protein structure prediction

    • Modeling of protein-protein and protein-substrate interactions

    • Prediction of mutational effects on structure and function

Functional and Genetic Analysis Tools:

  • CRISPR-Cas technologies:

    • Precise genome editing for detailed mutagenesis studies

    • CRISPRi for tunable gene repression

    • Base editing for specific amino acid substitutions without double-strand breaks

    • High-throughput functional screens

  • Single-cell technologies:

    • Single-cell RNA-seq to capture population heterogeneity

    • Time-lapse microscopy with fluorescent reporters

    • Spatial transcriptomics to examine expression in infection contexts

  • Protein engineering approaches:

    • Directed evolution to enhance YedZ properties

    • Creation of biosensors based on YedZ

    • Development of switchable YedZ variants for controlled activation

Systems Biology and Computational Approaches:

  • Multi-omics integration:

    • Combined analysis of genomics, transcriptomics, proteomics, and metabolomics data

    • Network modeling of YedZ interactions

    • Machine learning approaches to identify patterns across diverse datasets

  • Advanced bioinformatics:

    • Improved homology detection across diverse species

    • Evolutionary coupling analysis for structure prediction

    • Prediction of functional consequences of genetic variations

  • Quantum biology approaches:

    • Quantum mechanical modeling of electron transfer processes

    • Understanding fundamental mechanisms of heme-based catalysis

    • Design of inhibitors based on quantum principles

Translational Research Technologies:

  • Microfluidics and organ-on-chip models:

    • High-throughput screening of YedZ inhibitors

    • Mimicking host environments for infection studies

    • Real-time monitoring of bacterial responses

  • Nanobody and aptamer development:

    • Highly specific YedZ binders for structural and functional studies

    • Potential therapeutic development

    • Diagnostic applications for Salmonella detection

  • In situ structural and functional imaging:

    • Visualization of YedZ localization during infection

    • Activity-based probes for functional assessment

    • Super-resolution microscopy techniques for detailed localization studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.