Recombinant Salmonella agona Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Classification

Undecaprenyl-diphosphatase from Salmonella agona (strain SL483) is classified as an enzyme with the EC number 3.6.1.27, indicating its function as a hydrolase acting on acid anhydrides . The protein is encoded by the uppP gene (also identified by ordered locus name SeAg_B3391) and has been cataloged in the UniProt database with accession number B5F6A1 . This enzyme belongs to a class of integral membrane proteins that catalyze the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a critical carrier lipid in peptidoglycan synthesis .

Cell Wall Biosynthesis Pathway

Undecaprenyl-diphosphatase serves a crucial function in the peptidoglycan synthesis pathway, which is essential for bacterial cell wall formation and integrity. The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP or C55-P), a lipid carrier that plays a central role in the translocation of peptidoglycan precursors across the bacterial inner membrane . This reaction is vital for recycling the lipid carrier and maintaining the flow of peptidoglycan synthesis.

In Gram-negative bacteria like Salmonella, the peptidoglycan biosynthesis process begins with the cytoplasmic synthesis of UDP-MurNAc-pentapeptide, which is then transferred to undecaprenyl phosphate by the enzyme MurY, creating Lipid I . Subsequently, MurG catalyzes the conversion of Lipid I to Lipid II through the addition of N-acetyl-D-glucosamine . Lipid II is then flipped across the inner membrane to the periplasmic face, where it participates in the polymerization of the peptidoglycan layer . The undecaprenyl pyrophosphate released during this process must be dephosphorylated by uppP to regenerate the undecaprenyl phosphate carrier for subsequent rounds of peptidoglycan synthesis.

Role in Antimicrobial Resistance

Undecaprenyl-diphosphatase is also known as "Bacitracin resistance protein," highlighting its role in antimicrobial resistance mechanisms . Bacitracin is an antibiotic that binds to undecaprenyl pyrophosphate, preventing its dephosphorylation and thereby inhibiting peptidoglycan synthesis. By increasing the expression or activity of uppP, bacteria can overcome bacitracin inhibition by accelerating the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate.

While not directly addressed in the search results for Salmonella agona specifically, the connection between uppP and antimicrobial resistance suggests that this enzyme may contribute to S. agona's resistance profile. This is particularly relevant considering that S. agona has been increasingly recognized as a prominent cause of gastroenteritis and has demonstrated abilities to persist in people and form biofilms .

Salmonella agona Characteristics

Salmonella agona has been identified as the fourth most common non-typhoidal Salmonella serovar in the UK and is increasingly recognized as a significant cause of gastroenteritis . This serovar displays several notable characteristics that contribute to its pathogenicity:

  1. Strong biofilm formation capability, which aids in environmental persistence

  2. Ability to undergo genome rearrangement during infection

  3. Capacity to enter a viable but non-culturable state while remaining metabolically active

  4. Potential for developing chronic carriage in infected individuals

These characteristics suggest that S. agona employs sophisticated survival strategies similar to those observed in S. Typhi, the causative agent of typhoid fever .

Genomic Context of uppP in S. agona

The uppP gene in S. agona (strain SL483) is identified by the ordered locus name SeAg_B3391 . While specific details about the genomic neighborhood of uppP in S. agona are not provided in the search results, the gene appears to be conserved across Salmonella serovars, consistent with its essential function in bacterial cell wall synthesis.

Enzyme-Linked Immunosorbent Assay (ELISA) Applications

Recombinant S. agona uppP is commercially available for use in ELISA applications , suggesting its utility in:

  1. Detecting antibodies against S. agona in clinical samples

  2. Studying immune responses to S. agona infection

  3. Developing diagnostic tools for S. agona detection

These applications leverage the antigenic properties of uppP and its specificity to S. agona, potentially enabling more precise identification and characterization of S. agona infections.

Antimicrobial Drug Development Target

As an essential enzyme in bacterial cell wall synthesis and antimicrobial resistance, uppP represents a potential target for novel antimicrobial drug development. Inhibitors targeting uppP could potentially disrupt cell wall synthesis, leading to bacterial cell death or increased susceptibility to other antimicrobials.

The challenge in targeting uppP lies in its conservation across bacterial species, which may make it difficult to develop inhibitors specific to pathogenic strains without affecting beneficial bacteria. Nevertheless, structural differences between bacterial and human phosphatases may provide sufficient selectivity for therapeutic development.

Relevance to S. agona Persistence Studies

Recent research has focused on S. agona's ability to persist in human hosts, transitioning from acute to chronic infection . The genomic and phenotypic changes associated with this transition include genome rearrangements and altered biofilm formation capacity . While the specific role of uppP in this persistence has not been directly established, its function in cell wall homeostasis suggests it may contribute to S. agona's adaptability during different infection stages.

Studies have shown that isolates from patients with convalescent and temporary carriage of S. agona had significantly poorer ability to form biofilms compared to isolates from patients with acute illness . Understanding how cell wall synthesis enzymes like uppP are regulated during these different phases could provide insights into the mechanisms of bacterial persistence.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us and we will prioritize developing the specified tag.
Synonyms
uppP; SeAg_B3391; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
uppP
Target Protein Sequence
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Undecaprenyl-diphosphatase (UppP) in Salmonella agona?

UppP functions as a key enzyme in the lipid II cycle of cell wall biosynthesis, catalyzing the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This conversion is essential for recycling the lipid carrier that transports peptidoglycan precursors across the cytoplasmic membrane for incorporation into the growing cell wall. The dephosphorylation step is critical because UP serves as the acceptor molecule for cell wall precursors, enabling the continuation of the lipid II cycle. Studies in related bacteria have shown that UppP belongs to a family of integral membrane phosphatases that maintain cell envelope integrity by ensuring adequate UP pools .

What is known about the genetic organization of the uppP gene in Salmonella agona?

In bacteria like B. subtilis, uppP is the second gene of the yubA-uppP operon, and its expression is not induced by cell envelope stress conditions such as bacitracin exposure . While specific data on S. agona is limited in the provided search results, genomic studies of Salmonella have shown that core genome elements involved in essential cellular processes are generally highly conserved across serovars. The genetic context of uppP may include associations with genes involved in cell wall synthesis or membrane homeostasis. In S. agona, the genetic diversity observed between strains primarily reflects changes in the accessory genome rather than the core genome where essential genes like uppP would be located .

What are the preferred methods for cloning and expressing recombinant Salmonella agona UppP?

For cloning and expressing recombinant S. agona UppP, researchers typically employ bacterial expression systems based on E. coli hosts. The protocol generally involves:

  • PCR amplification of the uppP gene from S. agona genomic DNA using primers containing appropriate restriction sites

  • Cloning into expression vectors (such as pET series) with affinity tags (His6, GST) for purification

  • Transformation into expression hosts like E. coli BL21(DE3) or its derivatives

  • Induction of protein expression using IPTG at reduced temperatures (16-25°C) to enhance proper membrane protein folding

  • Membrane fraction isolation followed by detergent solubilization (typically using mild detergents like n-dodecyl-β-D-maltoside)

  • Purification via affinity chromatography and size exclusion chromatography

Since UppP is a membrane protein, special considerations for membrane protein expression are necessary, including the potential use of specialized E. coli strains designed for membrane protein expression .

What assays are available to measure UppP enzymatic activity in vitro?

Several methods can be employed to measure UppP enzymatic activity:

  • Radioactive phosphate release assay: Using [32P]-labeled UPP as substrate and measuring the release of inorganic phosphate

  • Colorimetric phosphate determination: Using the malachite green assay or similar methods to quantify released phosphate

  • HPLC-based methods: Monitoring the conversion of UPP to UP by reverse-phase HPLC

  • Mass spectrometry: Quantifying reaction products and substrates using LC-MS/MS

  • Coupled enzyme assays: Linking phosphate release to other enzymatic reactions that produce a measurable signal

For in vitro assays, it's crucial to establish appropriate reaction conditions, including optimal pH (typically 7.0-8.0), divalent cation concentrations (Mg2+ or Mn2+), and detergent concentrations that maintain enzyme stability without inhibiting activity .

How can researchers generate conditional mutants or depletion strains for studying UppP essentiality?

Studies in B. subtilis have demonstrated that uppP forms a synthetic lethal gene pair with bcrC, indicating the essential nature of UPP phosphatase activity . To study UppP function in S. agona, researchers can employ several approaches to generate conditional mutants:

  • Xylose-inducible expression systems: Creating strains where uppP is placed under control of an inducible promoter (e.g., PxylA), allowing for controlled depletion by removing the inducer

  • CRISPR-dCas9 knockdown systems: Using catalytically inactive Cas9 to repress uppP expression without genome editing

  • Temperature-sensitive alleles: Introducing mutations that render UppP functional at permissive temperatures but inactive at restrictive temperatures

  • Complementation with ectopic copies: Deleting the native uppP gene while providing a copy at an ectopic locus under an inducible promoter

These approaches allow researchers to study the physiological consequences of UppP depletion and identify synthetic lethal interactions, as demonstrated in B. subtilis where combined depletion of UppP and BcrC led to severe morphological defects and growth arrest .

How does UppP contribute to cell envelope stress response in Salmonella?

UppP plays a crucial role in connecting cell wall homeostasis with cell envelope stress response (CESR). Research in B. subtilis indicates that UPP phosphatase activity directly impacts the activation of stress response systems:

  • Depletion of UPP phosphatase activity leads to UP shortage and triggers σM-dependent promoter activity, indicating activation of the cell envelope stress response pathway

  • Even in wild-type cells, the absence of the undecaprenol kinase DgkA (which phosphorylates undecaprenol to UP) significantly elevates CESR promoter activity, demonstrating the link between UP pool maintenance and stress signaling

  • Limitation of UPP phosphatase activity sensitizes cells to cell wall-targeting antibiotics like bacitracin

While these specific observations come from B. subtilis, the fundamental connection between cell wall precursor cycling and stress response is likely conserved in S. agona. This suggests that UppP activity modulates the cell's ability to respond to cell envelope perturbations, potentially influencing pathogenesis and antibiotic resistance mechanisms .

What morphological changes occur in bacterial cells when UppP activity is compromised?

Depletion of UppP and other UPP phosphatases leads to distinct morphological changes that reflect disruptions in cell wall biosynthesis:

  • Cells with severely limited UPP phosphatase activity exhibit significant morphological aberrations, including:

    • Bent and swollen cell morphologies

    • Asymmetric cell divisions

    • Thickened cell poles

    • Cell lysis at high frequencies

  • In sporulating bacteria like B. subtilis, UppP depletion dramatically reduces sporulation efficiency

    • Spores appear phase-gray rather than phase-bright when examined microscopically

    • Heat resistance of spores is reduced to approximately 0.04% of wild-type levels

    • Defects suggest alterations in spore cortex or germ cell wall formation

These morphological changes highlight the critical role of UppP in maintaining cell envelope integrity and proper cell division. The specific morphological impacts in S. agona would need to be confirmed through targeted studies, but similar defects would be expected given the conserved nature of the lipid II cycle across bacterial species .

How does UppP activity influence susceptibility to cell wall-targeting antibiotics in Salmonella agona?

UppP activity directly impacts susceptibility to antibiotics that target the cell wall biosynthesis pathway, particularly those that interfere with the lipid II cycle:

  • Bacitracin resistance: Studies in B. subtilis show that UPP phosphatase activity is inversely correlated with bacitracin sensitivity. Bacitracin binds to UPP, preventing its dephosphorylation and depleting the UP pool. Strains with reduced UPP phosphatase activity show dramatically increased bacitracin sensitivity .

  • β-lactam resistance: Proper functioning of the lipid II cycle is essential for peptidoglycan synthesis, thus UppP depletion may increase susceptibility to β-lactams, which target transpeptidases involved in cross-linking peptidoglycan.

  • General cell wall stress: UppP depletion likely sensitizes cells to other cell wall stressors, including glycopeptides, lantibiotics, and antimicrobial peptides.

What is the potential of UppP as a target for novel antimicrobial development?

UppP represents a promising antimicrobial target for several reasons:

  • Essentiality: UPP phosphatase activity is essential for bacterial viability, as demonstrated by the synthetic lethality of UppP and BcrC in B. subtilis .

  • Conservation and specificity: UPP phosphatases are widely conserved across bacterial species but differ significantly from eukaryotic enzymes, potentially allowing for selective targeting.

  • Synergistic potential: Inhibitors of UppP could potentially synergize with existing antibiotics that target cell wall biosynthesis, such as β-lactams or bacitracin.

  • Resistance bypassing: Targeting UppP might help overcome resistance mechanisms to other cell wall-targeting antibiotics.

Drug development approaches might include:

  • High-throughput screening of chemical libraries against purified recombinant UppP

  • Structure-based drug design utilizing protein structure predictions or crystal structures

  • Repurposing screens of approved drugs for UppP inhibitory activity

  • Combination therapy approaches with existing antibiotics

The effectiveness of such strategies against multidrug-resistant S. agona strains would be particularly relevant given the recent emergence of highly resistant isolates containing plasmids with multiple resistance determinants .

How can genomic approaches be used to study UppP variation across Salmonella serovars?

Genomic approaches offer powerful tools for investigating UppP variation and its functional implications across Salmonella serovars:

  • Comparative genomics: Analysis of uppP gene sequences from diverse Salmonella isolates can reveal conservation patterns, polymorphisms, and selection pressures. Studies of S. agona have shown limited single nucleotide polymorphism (SNP) diversity in core genome elements, suggesting high conservation of essential genes .

  • Transcriptomic profiling: RNA-seq can identify differences in uppP expression levels across serovars or under different environmental conditions, potentially revealing serovar-specific regulatory mechanisms.

  • Genome-wide association studies (GWAS): Correlating specific uppP variants with phenotypic characteristics like antibiotic resistance profiles or virulence potential.

  • Synteny analysis: Examining conservation of gene order and organization around the uppP locus to identify potential operonic structures or regulatory elements that may differ between serovars.

  • Recombination detection: Identifying potential horizontal gene transfer events affecting uppP, similar to analyses that identified recombination events in S. agona introducing 3,164 SNPs across the core genome .

These approaches could reveal whether variations in UppP contribute to the distinct ecological niches or pathogenic potential of different Salmonella serovars, including S. agona's propensity to cause food-borne outbreaks.

What are the challenges in developing recombinant UppP as a research tool?

Developing recombinant UppP as a research tool presents several technical challenges:

  • Membrane protein expression: As an integral membrane protein, UppP is challenging to express in recombinant systems at levels suitable for biochemical studies. Issues include protein misfolding, aggregation, and toxicity to expression hosts.

  • Protein purification: Extracting and purifying active UppP requires careful optimization of detergent conditions to maintain native structure and activity.

  • Activity assays: Developing robust, high-throughput assays for UppP activity can be challenging due to the hydrophobic nature of its substrate (UPP) and product (UP).

  • Structural studies: Obtaining crystal structures or high-resolution cryo-EM structures of UppP is difficult due to the challenges inherent in membrane protein structural biology.

  • Heterologous function: Recombinant UppP may behave differently in heterologous systems compared to its native context, requiring careful validation of observed activities.

These challenges necessitate methodological innovations, including the use of specialized expression systems, fusion partners to enhance solubility, nanodiscs or other membrane mimetics for maintaining native-like environments, and development of sensitive activity assays suitable for biochemical characterization .

How can synthetic biology approaches be used to investigate UppP function in heterologous systems?

Synthetic biology offers innovative approaches to study UppP function in controlled contexts:

  • Minimal cell systems: Incorporating UppP into minimal or synthetic cells to study its function in simplified membrane environments.

  • Chimeric proteins: Creating fusion proteins between UppP and fluorescent tags or split reporter systems to monitor localization, dynamics, or protein-protein interactions.

  • Orthogonal expression systems: Developing genetic circuits that allow precise control of UppP expression independent of native regulatory networks.

  • Directed evolution: Engineering UppP variants with enhanced stability, activity, or altered substrate specificity through iterative rounds of mutagenesis and selection.

  • Cross-species complementation: Expressing S. agona UppP in other bacteria with uppP mutations to assess functional conservation and species-specific adaptations.

These approaches could reveal fundamental aspects of UppP function and potentially generate variants with enhanced properties for biotechnological applications or as tools for studying cell envelope biogenesis .

What role might UppP play in Salmonella agona virulence and host interactions?

While direct evidence for UppP's role in S. agona virulence is limited, its essential function in cell wall homeostasis suggests several potential contributions to pathogenesis:

  • Survival under stress: Proper UppP function likely enhances bacterial survival under host-imposed stresses, including antimicrobial peptides, pH fluctuations, and nutrient limitation.

  • Cell envelope integrity: UppP's role in maintaining cell envelope integrity may influence resistance to host defense mechanisms and the presentation of surface antigens.

  • Modulation of immune recognition: Alterations in peptidoglycan structure resulting from UppP dysfunction could affect recognition by host pattern recognition receptors like NOD1/2.

  • Biofilm formation: Cell wall homeostasis impacts biofilm formation, which is relevant for Salmonella persistence in both hosts and environments.

  • Stress response regulation: As observed in B. subtilis, UppP activity influences cell envelope stress responses , which could affect the expression of virulence factors in response to host environments.

S. agona has caused multiple food-borne outbreaks since its first isolation in 1952 , suggesting effective adaptation to both environmental persistence and host infection. The contribution of UppP to these capabilities warrants further investigation, particularly in the context of emerging multidrug-resistant strains .

How does UppP activity correlate with Salmonella agona adaptation to different environmental niches?

S. agona's ability to persist in diverse environments and cause outbreaks through various food sources suggests sophisticated adaptive mechanisms, potentially involving UppP:

  • Environmental persistence: UppP's contribution to cell envelope integrity likely influences survival under environmental stresses (temperature fluctuations, desiccation, antimicrobials).

  • Adaptation to food matrices: Different food environments may present varying challenges to cell envelope homeostasis, potentially selecting for optimal UppP activity levels.

  • Growth phase regulation: UppP activity may be differentially regulated during various growth phases to optimize cell wall synthesis according to environmental conditions.

  • Interspecies competition: Proper cell wall maintenance through UppP activity could enhance competitive fitness in mixed microbial communities.

  • Tolerance to food preservation methods: Cell envelope integrity influenced by UppP may contribute to tolerance of food preservation methods like acidification, salt, or antimicrobial compounds.

Genomic analyses of S. agona have revealed that its evolution since emergence in 1952 has involved population expansion in the 1960s, with dynamic changes in the accessory genome including bacteriophages, plasmids, and integrative conjugational elements . These horizontal gene transfer events may interact with core genome functions like UppP to shape S. agona's adaptability.

What are the best techniques for visualizing UppP localization in bacterial cells?

Visualizing UppP localization presents challenges due to its membrane-embedded nature, but several approaches can be employed:

  • Fluorescent protein fusions: Creating functional UppP-GFP or UppP-mCherry fusions, preferably with the fluorescent tag positioned to minimize interference with function.

  • Super-resolution microscopy techniques: Employing STORM, PALM, or STED microscopy to overcome the diffraction limit and achieve nanoscale resolution of UppP localization.

  • Immunofluorescence microscopy: Using antibodies against tagged versions of UppP or directly against the native protein if specific antibodies are available.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence visualization with electron microscopy to correlate UppP localization with ultrastructural features.

  • Proximity labeling approaches: Using techniques like APEX2 or BioID fused to UppP to identify proximal proteins and infer functional membrane domains.

When interpreting localization data, it's important to consider potential artifacts from protein overexpression or tag interference. Complementation assays should confirm that tagged UppP variants retain functionality, particularly given the essential nature of UPP phosphatase activity .

What strategies can be used to identify compounds that specifically inhibit UppP activity?

Several screening and design strategies can be employed to identify specific UppP inhibitors:

  • High-throughput enzymatic assays: Developing phosphatase assays amenable to microplate formats for screening chemical libraries.

  • Whole-cell screening with sensitized strains: Using bacterial strains with reduced UppP levels to identify compounds with enhanced activity against UppP-limited bacteria.

  • Structure-based virtual screening: If structural data becomes available, in silico docking of compound libraries to identify potential binding molecules.

  • Fragment-based drug discovery: Screening small chemical fragments that bind to UppP and subsequently optimizing or linking successful fragments.

  • Natural product screening: Testing extracts from microorganisms, particularly soil bacteria and fungi that naturally produce antibiotics.

  • Rational design based on substrate analogs: Developing UPP or UP analogs that may compete for the active site.

  • Phenotypic screens focusing on cell morphology: Identifying compounds that induce morphological changes similar to those observed in UppP-depleted strains .

The development of such inhibitors could provide valuable research tools and potentially lead to novel antibiotics effective against multidrug-resistant S. agona strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.