Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose Transferase (ArnC)

Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, commonly known as ArnC, is an enzyme that plays a crucial role in bacterial resistance to polymyxin antibiotics . Specifically, ArnC is involved in modifying lipid A, a component of the lipopolysaccharide (LPS) in the outer membrane of Salmonella and other Gram-negative bacteria .

Mechanism of Action

ArnC catalyzes the transfer of UDP-L-Ara4N from the cytosol to produce UndP-Ara4FN in the inner membrane . The UDP binding pocket involves 14 amino acid residues from the ArnC IH1/2 and A-loop, suggesting the location of the sugar-binding site in this protein . UDP binding results in conformational changes, with the IH2 shifting towards the UDP binding pocket in the UDP bound structure .

The GT-2 family of enzymes features a conserved DxD motif that binds divalent cations to coordinate the diphosphate group of the sugar donor . In ArnC, this motif corresponds to residues 100DADLQ104 .

Role in Polymyxin Resistance

The arn operon, which includes arnC, plays a critical role in polymyxin resistance in E. coli . Deletion of the arnC gene decreases the level of UndP-Ara4FN, while deletion of the adjacent arnD gene leads to the accumulation of UndP-Ara4FN, confirming ArnC's role in the formation of UndP-Ara4FN . The enzymes ArnBCDTEF modify lipid A with 4-deoxy-4-formamido-L-arabinose, reducing the net negative charge of the bacterial outer membrane and decreasing its affinity for polymyxins .

Research Findings and Significance

  • Cryo-EM Structures: Cryo-EM single particle reconstruction has been used to determine the structures of Salmonella typhimurium ArnC in apo and UDP bound forms, providing insights into its mechanism of action .

  • UDP Binding: UDP binding induces conformational changes in ArnC, stabilizing the A-loop and affecting the position of IH1 and IH2 .

  • Catalytic Activity: Key residues involved in ArnC catalytic activity have been identified through comparative analysis of ArnC structures with homologs GtrB and DPMS .

  • Antibiotic Resistance: ArnC's role in polymyxin resistance highlights its importance in the context of increasing antimicrobial resistance among Gram-negative pathogens .

  • FraB deglycase: Mutants lacking FraB are highly attenuated in mouse models of inflammation due to the toxic build-up of the substrate 6-phosphofructose-aspartate (6-P-F-Asp) .

  • Biofilm Formation: S. Agona strains have the capacity to form biofilms, transcriptional rewiring likely occurs during infection that reduces biofilm production, and these changes are maintained during subsequent laboratory growth .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SeAg_B2434; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase in Salmonella agona?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Salmonella agona catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate. This enzymatic action is part of a critical pathway that leads to the modification of lipid A with Ara4FN, which is directly linked to bacterial resistance against polymyxin and various cationic antimicrobial peptides . The modified arabinose becomes attached to lipid A, altering the charge properties of the bacterial outer membrane and decreasing the binding affinity of cationic antimicrobial compounds. When investigating this enzyme, researchers should consider its position within the broader arnBCADTEF operon that collectively contributes to lipid A modification pathways in Salmonella species.

How does the genomic context of arnC in Salmonella agona compare to other Salmonella serovars?

To study these genomic contexts effectively:

  • Employ both short-read and long-read sequencing approaches

  • Use genome structure (GS) analysis to identify potential rearrangements

  • Compare isolates from different infection phases to identify potential adaptations

What expression systems are most effective for producing recombinant Salmonella agona arnC?

For effective heterologous expression of Salmonella agona arnC, researchers should consider several expression systems based on experimental objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, rapid growth, simplified purificationMay form inclusion bodies requiring refoldingInitial characterization, antibody production
E. coli C43(DE3)Better for membrane proteins, reduces toxicityLower yield than BL21Functional studies requiring proper membrane insertion
Yeast (P. pastoris)Post-translational modifications, less endotoxinLonger expression time, complex mediaStructural studies requiring glycosylation
Cell-free systemsRapid expression, avoids toxicity issuesHigher cost, lower yieldRapid screening, toxic protein production

When designing expression constructs, incorporate a C-terminal His-tag rather than N-terminal to minimize interference with the N-terminal membrane-associating domain that is critical for proper enzyme localization. Optimal expression temperatures of 25-30°C rather than 37°C typically result in better folding of this membrane-associated enzyme.

How can site-directed mutagenesis be employed to identify critical residues in Salmonella agona arnC affecting antimicrobial resistance?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in Salmonella agona arnC. Based on the amino acid sequence homology with E. coli arnC (sharing approximately 85% identity), several residues can be targeted for mutagenesis studies :

  • Catalytic site residues: Targeting conserved motifs in the glycosyltransferase domain, particularly residues involved in UDP-Ara4FN binding.

  • Membrane interaction sites: Mutation of residues in the C-terminal membrane-spanning region (approximately residues 290-360 based on E. coli arnC) to assess impact on membrane localization.

  • Substrate binding pocket: Alterations to residues predicted to form the undecaprenyl phosphate binding site.

Methodological approach:

  • Generate point mutations using overlap extension PCR or commercial site-directed mutagenesis kits

  • Express wild-type and mutant proteins in parallel under identical conditions

  • Assess enzyme activity using an in vitro transferase assay with radiolabeled UDP-Ara4FN

  • Determine MIC values against polymyxin for S. agona strains complemented with mutant arnC variants

  • Confirm structural integrity of mutants using circular dichroism spectroscopy to ensure observed effects are due to specific residue functions rather than gross structural alterations

Researchers should pay particular attention to mutations affecting transitions between convalescent and chronic carrier states, as genome variation increases during this period .

What methodologies are most effective for studying the role of arnC in Salmonella agona persistence and biofilm formation?

Investigating the relationship between arnC activity and S. agona persistence requires multifaceted approaches that integrate molecular techniques with phenotypic assays:

  • Generation of arnC knockout and complemented strains:

    • Create precise deletions using λ-Red recombineering

    • Complement with wild-type and mutant alleles under native or inducible promoters

    • Include epitope tags for protein localization studies

  • Biofilm assessment protocols:

    • Crystal violet assays in multiple media conditions (minimal vs. rich media)

    • Confocal microscopy with fluorescent reporters to visualize biofilm architecture

    • Flow cell systems for dynamic biofilm formation under various stresses

  • Persistence models:

    • In vitro viable but non-culturable (VBNC) state induction and recovery assays

    • Cell culture models using intestinal epithelial cells (Caco-2, HT-29)

    • Murine infection models comparing colonization patterns between wild-type and arnC mutants

Research indicates that S. agona isolates from patients with convalescent and temporary carriage demonstrate significantly poorer biofilm formation ability compared to isolates from patients with acute illness (p = 0.004 and p = 0.002, respectively) . This counterintuitive finding suggests that arnC-mediated lipid A modifications may have divergent roles during different infection phases.

What are the optimal conditions for enzymatic assays to measure Salmonella agona arnC activity?

Establishing reliable enzymatic assays for recombinant Salmonella agona arnC requires careful optimization of reaction conditions:

ParameterOptimal RangeConsiderations
pH7.2-7.8Use HEPES or phosphate buffer systems
Temperature25-30°CHigher temperatures may reduce enzyme stability
Divalent cations2-5 mM Mg²⁺, 0.5-1 mM Mn²⁺Test individually and in combination
Detergent0.01-0.05% DDM or LMNGCritical for solubilizing the undecaprenyl phosphate substrate
UDP-Ara4FN10-100 μMMay require synthesis or isolation from bacterial cultures
Undecaprenyl phosphate10-50 μMSynthetic or natural sources, consider solubility limitations

Detection methods:

  • Radiometric assay: Using ¹⁴C or ³H-labeled UDP-Ara4FN to measure transfer to lipid fraction

  • HPLC-based assay: Monitoring decrease in UDP-Ara4FN or increase in UDP

  • Coupled enzymatic assay: Measuring UDP release through coupling with pyruvate kinase and lactate dehydrogenase

When evaluating enzyme kinetics, researchers should consider the biphasic kinetics often observed with lipid-modifying enzymes due to substrate aggregation effects. Michaelis-Menten parameters should be determined under conditions where substrate availability is not limited by micelle formation.

How can phylogenomic approaches be applied to study the evolution of arnC in Salmonella agona compared to other pathogenic bacteria?

Phylogenomic analysis of arnC provides valuable insights into its evolutionary history and functional adaptation across bacterial species:

  • Sequence collection and alignment:

    • Extract arnC sequences from diverse Salmonella serovars and other Enterobacteriaceae

    • Include sequences from both acute and persistent infection isolates

    • Use MUSCLE or MAFFT with optimized parameters for transmembrane proteins

  • Evolutionary model selection:

    • Test multiple substitution models (JTT, WAG, LG) with rate heterogeneity

    • Account for compositional bias in membrane-associated regions

    • Implement codon-based models to detect selection pressures

  • Tree construction methodologies:

    • Maximum likelihood (RAxML, IQ-TREE)

    • Bayesian inference (MrBayes, BEAST)

    • Reconciliation with species trees to identify potential horizontal gene transfer events

  • Selection analysis:

    • Calculate dN/dS ratios across lineages

    • Identify sites under positive or purifying selection

    • Correlate with functional domains and known resistance phenotypes

Phylogenomic analysis should be integrated with genome structure analysis, as S. agona demonstrates genomic rearrangements during persistence . The analysis should consider that while 94.2% of S. agona isolates maintain a conserved genome structure (GS1.0), alternative structures emerge during early stages of persistent infection, potentially affecting arnC regulation or expression .

What approaches should be used to investigate the regulatory networks controlling arnC expression in Salmonella agona under different environmental conditions?

Understanding arnC regulation requires comprehensive analysis of transcriptional, post-transcriptional, and post-translational control mechanisms:

  • Promoter analysis and transcription factor identification:

    • 5' RACE to precisely map transcription start sites

    • ChIP-seq to identify bound transcription factors

    • Reporter assays (luciferase, GFP) with promoter truncations and mutations

  • Environmental response profiling:

    • RNA-seq under various conditions:

      • pH variations (5.5-7.5)

      • Antimicrobial peptide exposure (sub-MIC)

      • Nutrient limitation

      • Biofilm vs. planktonic growth

    • Quantitative RT-PCR validation of key findings

  • Post-transcriptional regulation:

    • Identification of small RNAs affecting arnC mRNA stability

    • RNA immunoprecipitation to detect RNA-binding protein interactions

    • Translation efficiency analysis using ribosome profiling

  • Genetic network mapping:

    • Transposon insertion sequencing (Tn-Seq) to identify genes affecting arnC expression

    • Epistasis analysis with known regulatory elements (PhoP/PhoQ, PmrA/PmrB)

    • Construction of regulatory network models

When considering experimental design, researchers should account for the temporal dynamics of S. agona infections, as genetic diversity increases during early persistent infection stages (3 weeks-3 months) . This period shows increased SNP variation and genomic rearrangements that may influence regulatory networks controlling arnC expression .

How does arnC sequence variation in clinical Salmonella agona isolates correlate with antimicrobial resistance profiles?

Analysis of arnC sequence variation across clinical isolates provides critical insights into structure-function relationships and resistance mechanisms:

  • Sampling strategy:

    • Collect isolates representing diverse:

      • Geographical origins

      • Temporal distributions

      • Clinical presentations (acute vs. persistent)

      • Antimicrobial exposure histories

  • Sequence analysis pipeline:

    • Whole-genome sequencing (preferably combining short and long reads)

    • Extraction of arnC coding sequences and regulatory regions

    • Identification of non-synonymous vs. synonymous substitutions

    • Structural mapping of variants onto protein models

  • Phenotypic correlation studies:

    • Minimum inhibitory concentration (MIC) determination for polymyxins and other cationic antimicrobial peptides

    • Time-kill kinetics under varying antimicrobial concentrations

    • Heteroresistance assessment using population analysis profiling

  • Validation through genetic manipulation:

    • Allelic replacement of arnC variants in reference strains

    • Complementation of deletion mutants with variant alleles

    • Site-directed mutagenesis to introduce specific polymorphisms

Research should consider the observation that S. agona demonstrates increased genomic variation during the transition from acute to persistent infection . This diversification may represent an immune evasion mechanism that enables persistent infection to become established and may include adaptations in arnC and related genes affecting outer membrane remodeling .

What experimental approaches best elucidate the role of arnC in Salmonella agona's transition from acute to persistent infection?

Investigating arnC's role in the acute-to-persistent transition requires multiple complementary approaches:

  • Longitudinal sampling and analysis:

    • Serial isolate collection from patients with persistent S. agona infection

    • Whole-genome sequencing to track arnC mutations and expression changes

    • Phenotypic characterization of isolates from different time points

  • In vitro persistence models:

    • Nutrient limitation stress survival assays

    • Macrophage survival and replication tests

    • Biofilm formation capacity under various conditions

    • Induction and recovery from viable but non-culturable (VBNC) state

  • Comparative transcriptomics and proteomics:

    • RNA-seq comparing acute vs. persistent isolates

    • Protein expression profiling of membrane components

    • Lipidomics to assess lipid A modification patterns

    • Targeted metabolomics focusing on arabinose modification pathway

  • Animal model validation:

    • Murine models comparing colonization patterns between wild-type and arnC mutants

    • Competition assays between acute and persistent isolates

    • Histopathological examination of colonized tissues

Recent research reveals that S. agona isolates from convalescent and temporary carriers show significantly reduced biofilm formation compared to isolates from acute illness cases (p = 0.004 and p = 0.002, respectively) . This unexpected finding suggests that arnC-mediated lipid A modifications may have context-dependent roles during different infection phases, potentially switching from promoting acute virulence to supporting persistence through altered host immune interactions .

What are the most promising future research directions for understanding the role of recombinant Salmonella agona arnC in antimicrobial resistance?

Future investigations into recombinant Salmonella agona arnC should prioritize several key research directions:

  • Structure-based inhibitor design:

    • Development of high-throughput screening assays for arnC inhibitors

    • Structure-activity relationship studies on lead compounds

    • In vivo validation of inhibitor efficacy in infection models

    • Combination therapy approaches with existing antibiotics

  • Systems biology integration:

    • Multi-omics approaches linking arnC activity to global cellular responses

    • Network analysis identifying synthetic lethal interactions

    • Mathematical modeling of resistance emergence under selection pressure

    • Ecological studies examining arnC variation in environmental reservoirs

  • Host-pathogen interaction studies:

    • Impact of arnC-mediated lipid A modifications on host immune recognition

    • Adaptive immune responses to modified outer membrane components

    • Interplay between arnC activity and intestinal microbiome composition

    • Potential for vaccine development targeting arnC or modified structures

  • Technological advances:

    • CRISPR-based approaches for precise genome editing

    • Single-cell analysis of arnC expression heterogeneity

    • Improved structural biology methods for membrane proteins

    • Development of biosensors for real-time monitoring of lipid A modifications

Understanding the temporal dynamics of arnC expression and activity during the transition from acute to persistent infection presents a particularly promising avenue for future research. The observed increase in genomic variation during early persistent infection (3 weeks-3 months) suggests a critical window for evolutionary adaptation that may involve arnC and related pathways . This knowledge could potentially lead to targeted interventions that prevent the establishment of chronic S. agona carriage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.