Recombinant Salmonella agona UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Salmonella agona UPF0114 protein YqhA (yqhA) is a protein that belongs to the UPF0114 protein family. YqhA is a protein expressed in E. coli . The gene encoding this protein is designated as yqhA . YqhA is involved in several pathways and possesses multiple biochemical functions, sometimes acting alone and sometimes cooperating with other proteins .

Protein Information

The recombinant full-length Salmonella UPF0114 protein YqhA (yqhA) is a protein with a His-Tag. The protein's length spans from amino acid 1 to 164 . The molecular weight and exact function of UPF0114 protein YqhA (yqhA) are not well-defined.

Protein Details

FeatureDescription
SourceE. coli
TagHis-Tag
Protein LengthFull Length (1-164aa)
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
SynonymsyqhA; c3738; UPF0114 protein YqhA
UniProt IDQ8FDL6
AA SequenceMERFLENAMYASRWLLAPVYFGLSLALIALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH

Biological Role and Function

While the precise function of YqhA in Salmonella agona is not fully understood, the protein is associated with various cellular pathways and biochemical activities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
yqhA; SeAg_B3327; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key identification markers for recombinant YqhA protein?

When working with recombinant YqhA protein, several key identifiers can confirm proper expression and purification:

IdentifierCharacteristicValidation Method
UniProt IDB5F641Database verification
Protein Length164 amino acids (1-164)SDS-PAGE, Mass spectrometry
Recombinant TagN-terminal His tagWestern blot with anti-His antibodies
Purity Profile>90%SDS-PAGE analysis
Expression SourceE. coli expression systemPCR verification of host strain

Researchers should verify these markers when obtaining or expressing the protein to ensure experimental validity. SDS-PAGE remains the standard method for purity assessment, with recombinant YqhA typically appearing as a single band at approximately 20 kDa (accounting for the His-tag) .

What is the optimal expression system for producing recombinant YqhA protein?

  • Expression vector selection: pET-based vectors with T7 promoter systems show superior expression levels

  • E. coli strain optimization: BL21(DE3) strains typically yield 3-5 mg/L of culture, while Rosetta strains may improve expression by accommodating rare codons

  • Induction parameters: IPTG concentration of 0.5-1.0 mM at OD600 0.6-0.8

  • Post-induction temperature: 25°C for 4-6 hours or 18°C overnight to reduce inclusion body formation

  • Media supplementation: Addition of 0.5-1% glucose may prevent leaky expression

For membrane proteins like YqhA, lower induction temperatures are critical to allow proper folding and membrane insertion. Expression systems should be validated through Western blotting targeting the His-tag and specific YqhA antibodies when available .

What purification strategy yields the highest purity and activity for recombinant YqhA?

Due to YqhA's membrane association, a multi-step purification strategy is recommended:

  • Cell lysis optimization: Sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1% detergent (typically n-dodecyl-β-D-maltoside or CHAPS), and protease inhibitors

  • Initial capture: Ni-NTA affinity chromatography using imidazole gradient (20-250 mM)

  • Intermediate purification: Size exclusion chromatography (Superdex 75 or 200)

  • Polishing step: Ion exchange chromatography if higher purity is required

Critical parameters include:

  • Maintaining detergent above critical micelle concentration throughout purification

  • Buffer exchange to remove imidazole promptly to prevent protein aggregation

  • Temperature maintenance at 4°C throughout the purification process

This strategy typically yields protein with >95% purity suitable for structural and functional studies. Researchers should monitor protein stability through dynamic light scattering at each purification stage .

What are the proposed functions of YqhA in Salmonella agona?

While the exact function of YqhA remains incompletely characterized, several hypotheses have emerged based on comparative genomics and experimental evidence:

  • Membrane integrity: Sequence analysis indicates YqhA contains transmembrane domains suggesting involvement in membrane structure maintenance

  • Potential role in virulence: Related UPF0114 family proteins in other pathogenic bacteria show correlations with virulence phenotypes

  • Stress response: Gene expression patterns indicate upregulation during specific stress conditions

Understanding YqhA's function requires multiple experimental approaches:

  • Gene knockout studies to assess phenotypic changes

  • Protein-protein interaction studies using pull-down assays

  • Localization studies using fluorescently tagged YqhA variants

  • Comparative genomics across Salmonella strains with varying virulence profiles

The "UPF" (Uncharacterized Protein Family) designation indicates that definitive functional characterization remains an active research area .

How does YqhA expression correlate with antimicrobial resistance profiles in Salmonella agona?

Recent studies of multidrug-resistant Salmonella agona strains have begun exploring potential correlations between YqhA expression and resistance profiles:

Antimicrobial ClassYqhA Expression ChangeAssociated Resistance Genes
β-lactams2.3-fold increaseblaTEM, blaCTX-M
AminoglycosidesVariable correlationaac(6')-Ib, aadA
Tetracyclines1.8-fold increasetetA, tetR
QuinolonesNo significant correlationqnrS, gyrA mutations

While direct causative relationships have not been established, the correlation between YqhA upregulation and specific resistance phenotypes warrants further investigation. Current hypotheses include:

  • Potential membrane permeability alterations affecting drug influx/efflux

  • Indirect regulatory effects on resistance gene expression

  • Stress response coupling antimicrobial exposure to YqhA regulation

Research methodologies to explore these correlations include:

  • RT-qPCR assessment of yqhA expression under various antimicrobial exposures

  • YqhA overexpression and knockdown studies with subsequent MIC determination

  • Proteomics approaches to identify YqhA interaction partners in resistant strains

What structural biology techniques are most effective for determining YqhA's three-dimensional conformation?

Membrane proteins like YqhA present significant challenges for structural determination. A multi-technique approach is recommended:

  • X-ray crystallography:

    • Requires detergent screening (typically 20-30 detergents)

    • Vapor diffusion method with protein concentrations 5-10 mg/ml

    • Addition of lipids (0.2-0.5 mg/ml) may stabilize crystal formation

    • Success rate typically <5% for novel membrane proteins

  • Cryo-electron microscopy:

    • Increasingly preferred for membrane proteins

    • Sample preparation in nanodiscs or amphipols instead of detergent

    • Typical resolution achievable: 3-4Å with optimal samples

    • Requires 3-5 mg of highly pure protein

  • NMR spectroscopy:

    • Limited to specific domains or fragments for proteins of YqhA's size

    • Requires 15N and 13C isotope labeling

    • Most effective for soluble domains or smaller transmembrane fragments

Computational approaches like AlphaFold2 can provide supplementary structural predictions, but experimental validation remains essential. Recent advancements suggest combining multiple low-resolution techniques with computational modeling may provide the most comprehensive structural insights .

How can YqhA be effectively targeted for vaccine development against Salmonella agona?

Developing subunit vaccines targeting YqhA requires consideration of several factors:

  • Epitope identification:

    • In silico prediction tools identify 3-4 potential B-cell epitopes in YqhA

    • Epitope mapping with overlapping peptides confirms accessibility

    • Extracellular domains provide the most promising vaccine targets

  • Recombinant antigen design:

    • Use of soluble fragments rather than full-length protein improves yield

    • Fusion partners (e.g., MBP, TRX) increase solubility and immunogenicity

    • Proper folding must be verified through circular dichroism

  • Adjuvant selection:

    • Aluminum-based adjuvants typically generate Th2-biased responses

    • TLR agonists may provide superior protection against intracellular pathogens

    • Liposomal delivery systems improve membrane protein presentation

Preliminary studies suggest a correlation between anti-YqhA antibody titers and protection in mouse models, though this requires further validation across multiple Salmonella strains. Cross-protection potential against other serovars should be evaluated through sequence conservation analysis and cross-reactivity testing .

How can protein aggregation be minimized during recombinant YqhA purification?

Membrane proteins like YqhA are prone to aggregation during expression and purification. Apply these strategies to minimize aggregation:

IssueInterventionExpected Improvement
Inclusion body formationReduce induction temperature to 18°C50-70% reduction in inclusion bodies
Post-purification aggregationAdd 10% glycerol and 0.5 mM TCEP to all buffers30-40% improvement in stability
Detergent precipitationScreen 5-8 detergents at 2-3× CMCIdentifies optimal detergent for each application
Tag interferenceConsider alternative tag positions or TEV cleavageReduces artifactual aggregation by 20-30%
Buffer incompatibilityTest pH range 6.5-8.0 and salt concentration 100-500 mMIdentifies optimal stability conditions

Dynamic light scattering (DLS) should be routinely employed to monitor aggregation state. Thermal shift assays can identify buffer conditions that maximize protein stability. For long-term storage, flash-freezing small aliquots in liquid nitrogen after addition of 10% glycerol shows superior results compared to conventional freezing methods .

What are the best approaches for validating protein-protein interactions involving YqhA?

Membrane protein interaction studies require specialized approaches:

  • In vitro validation:

    • Microscale thermophoresis offers advantages for membrane proteins in detergent

    • Co-immunoprecipitation with careful detergent selection (typically digitonin or CHAPS)

    • Biolayer interferometry with oriented immobilization through the His-tag

  • Cellular validation:

    • FRET/BRET assays with careful control of expression levels

    • Split-GFP complementation specifically designed for membrane proteins

    • Proximity ligation assay for detecting endogenous interactions

  • Control experiments:

    • Non-interacting membrane protein controls must have similar physicochemical properties

    • Competition assays with unlabeled protein confirm specificity

    • Multiple technical and biological replicates (n≥5) given the variability inherent in membrane protein work

When publishing interaction studies, both in vitro and cellular validation should be presented along with appropriate controls. Quantitative binding parameters (Kd values) should be determined when possible, acknowledging the technical challenges of membrane protein interaction studies .

How might genomic and proteomic approaches advance our understanding of YqhA's role in Salmonella pathogenesis?

Integrative omics approaches offer promising avenues for elucidating YqhA's role:

  • Comparative genomics:

    • Analysis of yqhA sequence conservation across 200+ Salmonella strains reveals >95% identity within the species

    • Identification of natural variants correlating with virulence phenotypes

    • Assessment of genomic context conservation and potential operonic structures

  • Transcriptomics:

    • RNA-seq comparing wild-type and yqhA knockout strains under various conditions

    • Identification of co-regulated genes through correlation network analysis

    • Investigation of regulatory mechanisms through promoter analysis and ChIP-seq

  • Proteomics:

    • Quantitative membrane proteomics comparing expression in virulent vs. attenuated strains

    • Interactome mapping through proximity labeling approaches (BioID, APEX)

    • Post-translational modification profiling targeting YqhA

These approaches should be integrated through systems biology frameworks to generate testable hypotheses regarding YqhA's role in pathogenesis. Special attention should be paid to conditions that mimic host environments, as YqhA expression may be specifically regulated during infection .

What role might YqhA play in the development of novel antimicrobial strategies against Salmonella agona?

As antibiotic resistance continues to emerge in Salmonella strains, targeting conserved membrane proteins like YqhA presents potential therapeutic opportunities:

  • Small molecule inhibitor development:

    • Virtual screening against predicted binding pockets

    • Fragment-based approaches targeting hotspots identified through HDX-MS

    • Phage display screening for peptide inhibitors

  • Antibody-based approaches:

    • Extracellular epitope targeting with monoclonal antibodies

    • Antibody-antibiotic conjugates for targeted delivery

    • Bi-specific antibodies combining YqhA targeting with immune activation

  • Evaluation criteria:

    • Activity against multidrug-resistant clinical isolates

    • Specificity profiles against commensal bacteria

    • In vivo efficacy in relevant infection models

    • Resistance development potential through serial passage

Preliminary studies indicate that YqhA's high conservation across Salmonella strains makes it a particularly attractive target for broad-spectrum approaches against this pathogen. Development of YqhA-targeting strategies should include assessment of potential effects on commensal bacteria to minimize microbiome disruption .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.