Recombinant Salmonella agona UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; SeAg_B2476; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella agona UPF0208 membrane protein YfbV?

Recombinant Salmonella agona UPF0208 membrane protein YfbV (B5EZL8) is a 151-amino acid membrane protein that can be expressed with an N-terminal His tag in E. coli expression systems . The protein belongs to the UPF0208 family of uncharacterized proteins and likely plays roles in membrane-associated functions in Salmonella. The recombinant version allows for controlled expression and purification for experimental use through affinity chromatography methods.

How does YfbV protein structure compare between different Salmonella serovars?

YfbV proteins are highly conserved across Salmonella serovars, including Salmonella Agona and Salmonella Heidelberg, with both consisting of 151 amino acids . Comparison of the amino acid sequences reveals conservation of key structural elements, suggesting functional importance across different Salmonella lineages. For instance, the Salmonella Heidelberg YfbV (B4TBK3) shows significant sequence similarity to the Salmonella Agona version, indicating evolutionary conservation of this membrane protein.

What expression systems are most effective for producing functional recombinant YfbV?

E. coli expression systems are the standard for producing recombinant YfbV protein with functional integrity . The protein is typically expressed with an N-terminal His tag to facilitate purification, and expression conditions are optimized to ensure proper folding of this membrane protein. When designing expression experiments, researchers should consider:

  • Induction temperatures (lower temperatures often improve membrane protein folding)

  • Expression duration

  • Host strain selection (strains optimized for membrane protein expression)

  • Detergent selection for membrane protein solubilization

  • Purification strategy leveraging the His-tag for affinity chromatography

What experimental design approaches are most suitable for studying YfbV function?

A robust experimental design for YfbV functional studies should incorporate:

  • Independent variables: YfbV expression levels, environmental conditions, genetic background

  • Dependent variables: Cell phenotypes, protein interactions, membrane characteristics

  • Control for extraneous variables: Use of isogenic strains, standardized growth conditions

  • Randomization: Random assignment of samples to treatment groups

  • Replication: Multiple biological and technical replicates

Implementing a true experimental design with defined control and experimental groups is critical for establishing cause-effect relationships in YfbV function . For instance, comparing wild-type strains with yfbV deletion mutants under controlled conditions allows for direct assessment of YfbV's contribution to specific phenotypes.

How should researchers design experiments to investigate YfbV's role in Salmonella persistence?

Given the evidence that Salmonella Agona can persist in food processing environments for extended periods , experiments investigating YfbV's potential role in persistence should:

  • Compare expression levels of yfbV between acute infection isolates and persistent environmental isolates

  • Utilize temporal dynamics approaches similar to those used in the Salmonella Agona outbreak studies

  • Design controlled environmental stress experiments (desiccation, nutrient limitation, sanitizer exposure)

  • Implement longitudinal experimental designs tracking phenotypic changes over time

  • Include appropriate control strains (yfbV deletion mutants, complemented strains)

This experimental approach allows for assessment of YfbV's contribution to the remarkable persistence demonstrated in outbreak scenarios where the same strain was recovered 10 years apart .

What controls are essential when studying protein-protein interactions involving YfbV?

When investigating protein-protein interactions of YfbV, researchers should implement:

  • Negative controls: Empty vector expressions, unrelated membrane proteins

  • Positive controls: Known interaction partners of similar membrane proteins

  • Validation through orthogonal methods: Co-immunoprecipitation, bacterial two-hybrid, FRET

  • Detergent controls: Testing multiple detergent conditions to ensure interactions aren't artifacts

  • Competition assays to confirm specificity of observed interactions

The experimental design should account for the challenges of studying membrane protein interactions by incorporating these controls systematically .

How might YfbV contribute to Salmonella Agona's capacity for long-term persistence in food processing environments?

The Salmonella Agona outbreaks of 1998 and 2008 provide compelling evidence for bacterial persistence in food processing facilities . Research into YfbV's potential role should consider:

  • Expression analysis of yfbV in environmental stress conditions mimicking food processing facilities

  • Comparative genomic analysis of yfbV sequences between the 1998 and 2008 outbreak isolates

  • Evaluation of YfbV's potential role in biofilm formation

  • Assessment of YfbV-dependent stress responses to sanitizers and desiccation

  • Investigation of YfbV's interaction with the bacterial cell envelope under persistent infection conditions

Whole genome sequence analysis revealed only a mean of eight SNP differences between the 1998 and 2008 outbreak isolates , suggesting strong selection pressure maintaining genetic stability, potentially including conserved membrane proteins like YfbV.

What methods are appropriate for studying YfbV's potential role in the transition from acute to persistent Salmonella infection?

To investigate YfbV's potential role in persistence transitions, researchers should:

  • Design longitudinal experiments tracking Salmonella strains during extended infection periods

  • Compare wild-type and yfbV mutant strains for temporal dynamics of persistence establishment

  • Employ RNA-seq to identify transcriptional networks associated with YfbV during transition periods

  • Use proteomics to identify interaction partners specific to persistence phases

  • Implement appropriate statistical methods for time-series data analysis

Findings from such studies could provide insights into the mechanisms that allow Salmonella Agona to transition from causing acute gastroenteritis to establishing persistent infections, as observed in UK infection data .

How does YfbV expression change during different phases of Salmonella infection cycles?

Experimental approaches to address this question should include:

  • Time-course expression analysis using reporter fusions (yfbV promoter-GFP)

  • qRT-PCR quantification of yfbV transcript levels across infection phases

  • Western blot analysis of YfbV protein levels in different growth conditions

  • Single-cell analysis techniques to assess population heterogeneity in YfbV expression

  • In vivo expression studies using animal infection models

Researchers should implement true experimental designs with appropriate controls and statistical approaches for time-series data to accurately capture expression dynamics.

What purification strategies yield the highest quality recombinant YfbV protein?

Effective purification of recombinant His-tagged YfbV typically involves:

  • Initial cell lysis under conditions that preserve membrane protein structure

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using appropriate detergents (often DDM or LDAO)

  • IMAC (Immobilized Metal Affinity Chromatography) using the His-tag

  • Size exclusion chromatography for further purification

  • Quality control via SDS-PAGE to confirm >90% purity

The purified protein is typically stored in buffer containing stabilizing agents such as trehalose to prevent degradation during storage .

How can researchers effectively study membrane localization of YfbV?

Membrane localization studies for YfbV should employ:

  • Fluorescent protein fusions (ensuring fusion doesn't disrupt localization signals)

  • Immunofluorescence with antibodies against YfbV or its epitope tags

  • Subcellular fractionation followed by Western blot analysis

  • Electron microscopy with immunogold labeling

  • FRAP (Fluorescence Recovery After Photobleaching) to assess membrane dynamics

These approaches should be implemented with appropriate controls including other known membrane proteins and cytoplasmic markers to confirm specificity of membrane localization.

What are the best approaches for generating and validating yfbV knockout mutants in Salmonella?

Creating reliable yfbV knockout mutants requires:

  • Precise gene deletion strategies (lambda Red recombination or CRISPR-Cas9)

  • Confirmation of deletion by PCR, sequencing, and Western blot

  • Complementation controls (reintroducing yfbV on plasmid or chromosome)

  • Phenotypic validation comparing mutant and wild-type under multiple conditions

  • Transcriptomic analysis to identify potential polar effects

These methodological considerations ensure that phenotypes attributed to YfbV absence are specific and not due to experimental artifacts.

How do YfbV proteins from different Salmonella serovars compare functionally?

Researchers investigating functional differences between YfbV proteins from different serovars should:

  • Conduct complementation experiments where the yfbV gene from one serovar is expressed in a yfbV knockout of another serovar

  • Compare amino acid sequences and predict functional domains

  • Perform structure-function analyses through site-directed mutagenesis

  • Evaluate protein-protein interaction networks across serovars

  • Assess phenotypic differences in isogenic strains expressing different YfbV variants

The table below compares key features of YfbV from two Salmonella serovars:

FeatureS. Agona YfbVS. Heidelberg YfbV
UniProt IDB5EZL8B4TBK3
Length151 aa151 aa
ExpressionE. coliE. coli
TagN-terminal HisN-terminal His
StorageLyophilized powderLyophilized powder

This comparative approach helps identify serovar-specific adaptations versus core conserved functions of YfbV .

What bioinformatic tools are most effective for analyzing YfbV sequence conservation and predicting function?

Effective bioinformatic analysis of YfbV should employ:

  • Multiple sequence alignment tools (MUSCLE, CLUSTAL)

  • Phylogenetic analysis software (MEGA, RAxML)

  • Protein structure prediction tools (AlphaFold, I-TASSER)

  • Transmembrane domain predictors (TMHMM, Phobius)

  • Genomic context analysis tools to identify conserved genetic neighborhoods

Researchers should also consider comparative approaches similar to those used in the Salmonella Agona outbreak studies, where whole genome sequencing and phylogenetic analysis revealed relationships between isolates .

How might YfbV research contribute to understanding Salmonella adaptation during outbreaks?

Future YfbV research could enhance understanding of Salmonella adaptation by:

  • Analyzing yfbV sequence variation across outbreak-associated isolates

  • Investigating YfbV's potential role in stress responses relevant to food production environments

  • Evaluating whether YfbV contributes to the remarkable genetic stability observed in persistent Salmonella lineages

  • Assessing if YfbV functions in environmental sensing or response mechanisms

  • Determining if YfbV plays a role in biofilm formation in food processing environments

Such research would build upon the phylogenomic findings from Salmonella Agona outbreaks that demonstrated direct descendant relationships between temporally separated outbreak strains .

What role might YfbV play in the transition from acute to persistent Salmonella infection in humans?

Investigation of YfbV's potential role in persistence should consider:

  • Expression analysis comparing acute and persistent infection isolates

  • Animal models of persistent Salmonella infection with wild-type versus yfbV mutants

  • Host-pathogen interaction studies focusing on chronic infection stages

  • Comparative genomics of yfbV between transient and persistent clinical isolates

  • Functional analysis of YfbV's contribution to immune evasion mechanisms

This research direction aligns with emerging understanding of Salmonella Agona's ability to transition from acute gastroenteritis to persistent infection, as documented in UK infection data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.