Recombinant Salmonella agona UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yobD; SeAg_B1299; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNINDLEKIYKLLIENQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0266 membrane protein yobD in Salmonella?

The UPF0266 membrane protein yobD is a transmembrane protein found in various Salmonella species, including S. typhimurium. It belongs to the UPF0266 protein family, which consists of proteins with conserved structures but largely unknown functions. The protein is encoded by the yobD gene (STM1833 in S. typhimurium LT2) and contains 156 amino acids forming a membrane-spanning structure . Current research suggests these proteins may play roles in bacterial membrane integrity, stress response, or potentially in pathogenicity mechanisms, though specific functions remain under investigation.

How should recombinant yobD protein be properly stored and handled for experimental use?

For optimal stability and experimental reproducibility, recombinant yobD protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine use or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and activity. For experiments requiring high protein quality, single-use aliquots are recommended to prevent degradation. When handling the protein, maintain a consistent temperature and consider adding protease inhibitors if working with crude preparations.

What expression systems are most effective for producing functional recombinant Salmonella yobD protein?

The expression of membrane proteins like yobD presents unique challenges due to their hydrophobic nature and complex folding requirements. For successful production of functional recombinant Salmonella yobD, bacterial expression systems such as E. coli BL21(DE3) or C41(DE3) strains are often effective when the protein is expressed with fusion tags (His, GST, or MBP) to enhance solubility.

Expression should be conducted at lower temperatures (16-25°C) with reduced inducer concentrations to allow proper membrane insertion and folding. For membrane proteins that prove difficult to express in bacterial systems, eukaryotic alternatives such as insect cells (using baculovirus expression systems) can provide better yields of properly folded protein, though at higher cost and complexity. The expression region for the full-length protein corresponds to amino acids 1-156 .

What purification strategies yield the highest purity and activity for recombinant yobD protein?

A multi-step purification approach typically yields the best results for membrane proteins like yobD:

  • Membrane Fraction Isolation: Differential centrifugation to separate membrane fractions from cellular debris.

  • Detergent Solubilization: Careful selection of detergents (n-dodecyl-β-D-maltoside or CHAPS are often suitable) to extract the protein while maintaining its native conformation.

  • Affinity Chromatography: Using fusion tags (commonly His-tag) for initial capture.

  • Size Exclusion Chromatography: To separate monomeric protein from aggregates.

  • Ion Exchange Chromatography: As a polishing step to remove contaminants with different charge properties.

Typical yields for optimized protocols range from 1-5 mg of purified protein per liter of bacterial culture. Throughout purification, maintaining a stable buffer environment with appropriate detergent concentrations above their critical micelle concentration is essential for preserving protein activity.

What experimental approaches can determine the membrane topology of yobD protein?

Several complementary techniques can effectively determine the membrane topology of yobD:

  • Cysteine Scanning Mutagenesis: Introducing cysteine residues at various positions followed by labeling with membrane-impermeable reagents.

  • Protease Accessibility Assays: Limited proteolysis of membrane preparations to identify exposed regions.

  • Fluorescence Microscopy: Using GFP fusions at different termini to determine their cellular localization.

  • Computational Prediction: Tools such as TMHMM, HMMTOP, and Phobius can predict transmembrane segments.

A combined approach using both experimental and computational methods provides the most reliable topology model. Based on sequence analysis, yobD likely contains multiple transmembrane helices with both N and C termini potentially facing the cytoplasmic side, though experimental verification is recommended for definitive topology mapping.

How can researchers assess potential interactions between yobD and other bacterial proteins?

Multiple methods can be employed to characterize yobD protein interactions:

TechniqueAdvantagesLimitationsBest Used For
Bacterial Two-HybridIn vivo system, accommodates membrane proteinsPotential false positivesInitial screening
Co-immunoprecipitationCaptures native complexesRequires high-quality antibodiesVerifying direct interactions
Crosslinking Mass SpectrometryIdentifies interaction sitesComplex data analysisDetailed interaction mapping
Surface Plasmon ResonanceReal-time kinetics, no labels requiredRequires purified proteinsQuantifying binding affinities
Pull-down AssaysRelatively simpleMay detect non-physiological interactionsConfirming predicted interactions

A step-wise approach starting with screening methods followed by validation using multiple orthogonal techniques is recommended to establish confident interaction networks for yobD protein.

How does the yobD gene sequence vary across different Salmonella serovars, and what might this suggest about its function?

Comparative genomic analysis of the yobD gene across Salmonella serovars reveals both conserved and variable regions. The core transmembrane domains typically show high conservation, suggesting functional constraints on these regions. In contrast, loop regions may display greater variability, particularly between distinct serovars like S. typhimurium and S. Agona.

What role might yobD play in Salmonella persistence in food processing environments?

The persistence of Salmonella in food processing environments, as exemplified by the S. Agona outbreaks separated by a decade (1998-2008) but traced to the same facility, may involve membrane proteins like yobD . While direct evidence for yobD's role in persistence is limited in the available literature, membrane proteins often contribute to:

  • Biofilm Formation: Membrane proteins can mediate initial attachment to surfaces and cell-cell interactions within biofilms.

  • Stress Response: They may provide protection against desiccation, disinfectants, and other environmental stresses.

  • Viable but Non-culturable State: S. Agona can enter a viable but non-culturable state while remaining metabolically active, which may involve membrane protein remodeling .

  • Genomic Stability: While S. Agona shows genome rearrangements during persistence, certain membrane proteins may be conserved to maintain essential functions .

Research examining differential expression of yobD under conditions that promote persistence (low nutrients, desiccation, disinfectant exposure) could help elucidate its potential role in Salmonella survival in food processing environments.

How can CRISPR-Cas9 genome editing be optimized for studying yobD function in Salmonella?

Optimizing CRISPR-Cas9 genome editing for studying yobD function requires careful consideration of several parameters:

  • gRNA Design: Select guide RNAs with minimal off-target effects using tools like CHOPCHOP or CRISPOR, focusing on targets within the coding region of yobD.

  • Delivery Method: Electroporation of ribonucleoprotein complexes (Cas9 protein + gRNA) often achieves higher editing efficiency in Salmonella than plasmid-based approaches.

  • Homology-Directed Repair: For precise modifications, design repair templates with approximately 500-1000 bp homology arms flanking the target site.

  • Selection Strategy: Incorporate antibiotic resistance markers flanked by FRT sites for subsequent removal to create scarless mutations.

  • Verification: Use sequencing to confirm desired edits and whole-genome sequencing to check for off-target modifications.

For functional studies, consider creating point mutations in conserved residues rather than complete knockouts, as the latter may be lethal if yobD serves essential functions. Alternative approaches include creating conditional knockdowns using inducible promoters or CRISPRi systems.

What high-throughput screening methods can identify compounds that interact with or inhibit yobD function?

Several high-throughput screening approaches can identify compounds that interact with yobD:

  • Thermal Shift Assays: Measure changes in protein thermal stability upon compound binding using differential scanning fluorimetry.

  • Surface Plasmon Resonance Arrays: Screen compound libraries for direct binding to immobilized yobD protein.

  • Whole-Cell Phenotypic Screens: Compare compound effects on wild-type versus yobD-mutant Salmonella to identify yobD-specific inhibitors.

  • Bacterial Three-Hybrid Systems: Adapt yeast three-hybrid approaches to detect compound-protein interactions in bacterial cells.

  • In Silico Screening: Use structural models (if available) for virtual screening of compound libraries.

Once hits are identified, secondary assays should verify target engagement and specificity. For membrane proteins like yobD, incorporating the protein into nanodiscs or liposomes can maintain native conformations during screening processes and reduce false positives from non-specific membrane interactions.

How can single-cell techniques be applied to understand the heterogeneity of yobD expression in Salmonella populations?

Single-cell techniques offer powerful approaches to examine heterogeneous expression patterns that may be masked in population-level studies:

  • Single-Cell RNA-Seq: Captures transcriptomic profiles of individual bacterial cells to identify subpopulations with differential yobD expression.

  • Fluorescent Reporter Systems: Creating translational fusions of yobD with fluorescent proteins allows real-time monitoring of expression in living cells.

  • Flow Cytometry and Cell Sorting: Quantifies expression levels across thousands of individual cells and enables isolation of cells with distinct expression profiles.

  • Microfluidics: Enables tracking of individual cells over time and under changing environmental conditions.

These approaches are particularly relevant for studying yobD in the context of Salmonella persistence, as seen in the S. Agona outbreaks, where population heterogeneity may contribute to survival. For example, differential expression of membrane proteins might create subpopulations with enhanced stress resistance or biofilm-forming capacity, contributing to the bacterium's ability to persist in food processing environments for extended periods .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.