Recombinant Salmonella agona UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; SeAg_B1466; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGIQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Recombinant Salmonella agona UPF0283 membrane protein ycjF?

Recombinant Salmonella agona UPF0283 membrane protein ycjF (UniProt ID: B5F588) is a full-length protein comprising 353 amino acids. The protein is primarily characterized as a membrane protein, suggesting it contains hydrophobic regions that anchor it within the bacterial membrane. When produced recombinantly, it is typically expressed with an N-terminal His tag to facilitate purification, though tag types may vary depending on the production process . The protein's membrane-associated nature makes it particularly relevant for studies investigating bacterial membrane integrity and function.

How does the ycjF protein sequence compare between different Salmonella serovars?

Comparative analysis of ycjF protein sequences between Salmonella serovars reveals high conservation with minor variations. For example, when comparing S. agona ycjF (B5F588) with S. gallinarum ycjF (B5R9Z8), the sequences show remarkable similarity with only a few amino acid substitutions . Key differences include:

PositionS. agona (B5F588)S. gallinarum (B5R9Z8)Amino Acid Change
~70GIQWTMNAGVQWTMNAI → V
~140ALIVGAGALIIGAGV → I
~220VQPVLDAQVQLVLDAQP → L
~240IAVSPLALIAVSSLALP → S

These minor variations might contribute to species-specific adaptations while maintaining the core functionality of the protein . The high sequence conservation suggests an important conserved role for this protein across Salmonella species.

What expression systems are optimal for producing recombinant S. agona ycjF protein?

The most commonly utilized expression system for recombinant S. agona UPF0283 membrane protein ycjF is Escherichia coli. This bacterial expression system offers several advantages for membrane protein production, including high yield and relatively straightforward scale-up protocols . The protein is typically expressed with an N-terminal His tag to facilitate purification, though the specific tag may vary depending on the production requirements .

Alternative expression systems reported in product literature include:

  • Yeast-based expression systems

  • Baculovirus-infected insect cells

  • Mammalian cell expression platforms

What are the optimal storage conditions for maintaining ycjF protein stability?

Maintaining stability of recombinant S. agona ycjF protein requires careful attention to storage conditions. Based on multiple product specifications, the following storage recommendations should be implemented:

  • Long-term storage: Store at -20°C to -80°C, with the latter recommended for extended preservation periods .

  • Working aliquots: Store at 4°C for up to one week to minimize degradation .

  • Buffer composition: Tris-based buffer with 50% glycerol has been optimized to enhance protein stability .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can compromise protein integrity. Preparing multiple small-volume aliquots upon initial reconstitution is advisable .

For lyophilized preparations, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol (final concentration 5-50%) before aliquoting for long-term storage . These precautions help preserve the native structure and functional properties of the recombinant protein.

How can recombinant ycjF protein be used in Salmonella pathogenesis studies?

Recombinant S. agona ycjF protein can serve as a valuable tool in multiple pathogenesis research applications:

  • Antibody development: The purified protein can be used to generate specific antibodies for tracking ycjF expression and localization during infection processes .

  • Host-pathogen interaction studies: Given that membrane proteins often interface with host cells, recombinant ycjF might be employed to investigate potential interactions with host cellular components .

  • Persistence mechanism investigation: S. agona has been identified as capable of transitioning from acute to persistent infection. As a membrane protein, ycjF may play a role in this transition, making it relevant for studies exploring bacterial persistence mechanisms .

  • Comparative virulence analysis: By developing tools based on recombinant ycjF, researchers can examine the protein's expression levels across different S. agona isolates associated with varying virulence profiles .

  • Structure-function relationship studies: Purified recombinant protein enables detailed structural analyses through techniques such as X-ray crystallography or cryo-electron microscopy, potentially revealing functional domains relevant to pathogenesis .

The UPF0283 designation indicates this is a protein of unknown function, making it an intriguing target for novel discoveries in Salmonella pathogenesis research .

What role might ycjF play in biofilm formation by Salmonella agona?

S. agona has been identified as a strong biofilm-forming serovar, which contributes to its persistence in both environmental and host settings . While the direct role of ycjF in biofilm formation remains to be fully characterized, several aspects warrant investigation:

  • Membrane protein contribution: As a membrane protein, ycjF may influence cell surface properties that affect initial attachment phases of biofilm development .

  • Persistence correlation: Research has shown that S. agona can undergo genome rearrangement and enter a viable but non-culturable state while remaining metabolically active. These characteristics have been associated with biofilm establishment and the transition from acute to chronic infection .

  • Experimental evidence in related contexts: A study examining biofilm formation in S. agona identified several key genes associated with this process, including attachment-related genes (adrA, csgB, csgD, fimH, glyA), regulatory genes (csrA, ompR, sirA), and quorum sensing-related genes (luxS, pfs, sdiA) . While ycjF was not specifically highlighted, its membrane localization positions it as a potential player in the complex network of factors influencing biofilm development.

Interestingly, research has shown that isolates from patients with convalescent and temporary carriage of S. agona had significantly poorer ability to form biofilms compared to isolates from patients with acute illness (p = 0.004 and p = 0.002, respectively) . This observation suggests that biofilm formation capacity may evolve during persistent infection, potentially involving membrane proteins like ycjF.

How might ycjF contribute to Salmonella agona's transition from acute to persistent infection?

The transition from acute to persistent infection in Salmonella agona involves complex adaptive mechanisms at both the genomic and phenotypic levels. While the specific role of ycjF in this process requires further investigation, several lines of evidence suggest potential contributions:

  • Genomic diversity during persistence: Research has revealed increased SNP variation during the early stages of persistent S. agona infection, indicating either population expansion after acute infection or a population bottleneck during transition to persistent infection . This genomic plasticity may affect membrane proteins like ycjF, potentially altering their structure or expression patterns.

  • Membrane protein adaptation: As a membrane protein, ycjF may play a role in modulating the bacterium's interaction with host immune components or adapting to environmental stresses encountered during persistent infection .

  • Parallels with S. Typhi persistence: The search results indicate that S. agona employs strategies similar to S. Typhi (the causative agent of typhoid fever) during persistent infection, including genome rearrangement and biofilm establishment . Given these parallels, investigating ycjF's role in the context of known S. Typhi persistence mechanisms could provide valuable insights.

  • Population dynamics during persistence: A study examining S. agona isolates from different stages of infection found genomic structure variations typically associated with early, convalescent carriage (3 weeks–3 months), suggesting that population expansion and genomic variation might be key to establishing persistence . Membrane proteins like ycjF could be affected by or contribute to these dynamics.

What experimental approaches can determine the membrane topology of ycjF?

Understanding the membrane topology of ycjF is crucial for elucidating its function. Several methodological approaches can be employed:

  • Computational prediction: Initial topology analysis can be performed using algorithms that predict transmembrane domains based on the hydrophobicity profile of the amino acid sequence. The ycjF sequence (MSEPLKPRIDFAEPLKEE...SKSSPEK) can be analyzed to identify probable membrane-spanning regions .

  • Protease protection assays: This experimental approach involves treating intact bacterial cells or membrane vesicles with proteases. Regions of the protein exposed to the extracellular environment will be digested, while those protected within the membrane or facing the cytoplasm remain intact. Subsequent analysis by Western blotting with antibodies targeting different protein regions can reveal the orientation of various domains.

  • Cysteine scanning mutagenesis: This approach involves creating a series of mutants, each with a single cysteine residue at different positions along the protein. Treatment with membrane-impermeable sulfhydryl reagents followed by mass spectrometry analysis can identify which cysteine residues are accessible, thus mapping exposed regions.

  • GFP fusion analysis: Creating fusion proteins with GFP at different positions in ycjF can help determine the protein's topology, as GFP fluorescence requires proper folding in the cytoplasm.

  • Cryo-electron microscopy: For structural determination at high resolution, purified recombinant ycjF can be reconstituted into lipid nanodiscs or detergent micelles for cryo-EM analysis, potentially revealing its complete membrane topology.

These complementary approaches can provide comprehensive insights into the spatial arrangement of ycjF within the bacterial membrane, which is essential for understanding its functional role.

What controls should be included when studying ycjF's role in membrane integrity?

When investigating ycjF's role in membrane integrity, rigorous experimental design with appropriate controls is essential:

  • Genetic controls:

    • ycjF knockout strain: Create a clean deletion mutant of ycjF to assess the impact on membrane integrity

    • Complemented strain: Re-introduce wild-type ycjF on a plasmid to confirm phenotype restoration

    • Point mutation variants: Introduce specific mutations to identify critical residues

  • Phenotypic controls:

    • Known membrane integrity mutants (e.g., in outer membrane proteins)

    • Wild-type parental strain

    • Strains with mutations in functionally related genes

  • Assay-specific controls:

    • For membrane permeability assays: Include controls treated with known membrane-disrupting agents (e.g., polymyxin B)

    • For membrane potential measurements: Include controls treated with protonophores (e.g., CCCP)

    • For morphological studies: Examine multiple growth conditions and growth phases

  • Expression controls:

    • Verify ycjF expression levels in complemented strains

    • Monitor potential polar effects on neighboring genes when creating knockout strains

    • Include empty vector controls for complementation experiments

These controls help distinguish specific effects related to ycjF function from general perturbations to membrane physiology and ensure the reliability and reproducibility of experimental findings.

How can I design experiments to study the impact of ycjF mutations on Salmonella persistence?

Designing experiments to investigate the impact of ycjF mutations on Salmonella persistence requires a multi-faceted approach that addresses both in vitro and in vivo aspects:

  • Mutation strategy design:

    • Create a clean deletion mutant (ΔycjF)

    • Generate point mutations targeting conserved residues

    • Develop complementation constructs (wild-type and mutant variants)

    • Consider conditional expression systems to examine timing-dependent effects

  • In vitro persistence models:

    • Nutrient limitation assays: Compare survival of wild-type and mutant strains under nutrient-restricted conditions

    • Stress tolerance tests: Examine resistance to oxidative stress, pH stress, and antimicrobial peptides

    • Biofilm formation assays: Quantify biofilm development using crystal violet staining

    • Long-term stationary phase cultures: Monitor viability over extended periods (weeks to months)

  • Single-cell analysis approaches:

    • Fluorescent reporter systems to track gene expression in persister subpopulations

    • Time-lapse microscopy to observe morphological changes and division patterns

    • Flow cytometry to quantify persister cell frequencies

  • In vivo persistence models:

    • Mouse infection models comparing wild-type and ycjF mutant strains

    • Organ colonization analysis at different timepoints post-infection

    • Competitive index experiments (co-infection with wild-type and mutant)

    • Antibiotic treatment regimens to enrich for persister populations

  • Genomic analysis:

    • Monitor SNP accumulation in wild-type versus ycjF mutant populations during experimental persistence

    • Assess genomic structure variations that occur during persistence

    • Perform transcriptomic analysis to identify compensatory responses in ycjF mutants

This comprehensive experimental design framework enables detailed characterization of ycjF's contribution to S. agona persistence mechanisms, building on the observation that S. agona undergoes specific genomic changes during the transition from acute to persistent infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.