Recombinant Salmonella agona UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella Agona UPF0442 Protein YjjB (YjjB)

Recombinant Salmonella Agona UPF0442 protein YjjB is a bioengineered protein derived from the yjjB gene in Salmonella Agona, a serovar associated with foodborne illnesses and persistent human infections. This full-length protein (1–157 amino acids) is produced through recombinant expression systems, typically in E. coli, and is used in research to study bacterial pathogenesis, protein interactions, and diagnostic applications. Its UniProt identifier is B5F504, and it is also referred to as SeAg_B4866 or UPF0442 protein YjjB .

Production Overview

ParameterDetails
Host OrganismEscherichia coli
TagN-terminal His-tag (in most formulations) ; tag type may vary
Purity>90% (SDS-PAGE validated) ; ≥85% (other commercial preparations)
Storage BufferTris/PBS-based buffer with 6% trehalose or Tris-based buffer with 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol recommended for stability

Hypothetical Function and Pathways

While yjjB is annotated as a hypothetical protein, bioinformatics analyses suggest involvement in:

  • Membrane integrity: Based on sequence homology to DUF3815-containing proteins .

  • Stress response: Potential links to pathways regulating bacterial adaptation under environmental stressors .

Applications in Research and Diagnostics

Use CaseDetails
Antibody DetectionELISA assays using recombinant YjjB as antigen to screen for anti-Salmonella antibodies .
Protein Interaction StudiesInvestigating interactions with host proteins or bacterial virulence factors .
Pathogenicity ModelsStudying Salmonella persistence mechanisms in human carriers .

Genomic Context in Salmonella Agona

Phylogenomic studies of Salmonella Agona isolates revealed:

  • Genome stability: The majority of isolates retain a conserved genome structure (GS1.0), with rare rearrangements linked to early infection stages .

  • SNP accumulation: Increased single nucleotide polymorphisms (SNPs) during convalescent phases, suggesting population expansion or immune evasion .

Limitations and Gaps

  • Functional ambiguity: No direct evidence links yjjB to biofilm formation, virulence, or metabolic pathways in Salmonella .

  • Biofilm role: Studies on Salmonella biofilm capacity did not identify yjjB as a critical regulator .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjjB; SeAg_B4866; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0442 protein yjjB in Salmonella agona and what is known about its function?

The UPF0442 protein yjjB is a membrane protein found in Salmonella agona (strain SL483) with a full-length sequence of 157 amino acids . As indicated by its UPF (Uncharacterized Protein Family) designation, its precise function remains to be fully elucidated. Subcellular localization studies indicate it is a multi-pass membrane protein integrated into the cell membrane . The protein belongs to the UPF0442 family, suggesting conserved structural features across related proteins .

To investigate its function, researchers should consider:

  • Comparative genomics approaches with homologous proteins in related species

  • Membrane topology mapping using reporter fusions

  • Gene knockout/complementation studies to assess phenotypic changes

  • Protein-protein interaction studies to identify binding partners

How conserved is the yjjB protein sequence across different Salmonella species?

Comparison of the yjjB protein sequences from Salmonella agona (B5F504) and Salmonella schwarzengrund (B4TU22) reveals remarkable conservation, with identical amino acid sequences between these species . This perfect sequence conservation suggests essential functional roles that have been maintained through evolution.

When comparing to more distant relatives, such as E. coli strains (P0ADD4/P18389), subtle sequence differences emerge . For instance, the E. coli version shows sequence variations that might reflect species-specific adaptations while maintaining core structural elements. This high conservation pattern is typical of proteins with fundamental cellular functions.

What expression systems are optimal for producing recombinant yjjB protein?

For recombinant expression of Salmonella agona yjjB protein, E. coli has been successfully employed as an expression host . As yjjB is a membrane protein, special considerations for expression include:

  • Selection of appropriate E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Modulation of expression temperature (typically lower temperatures of 16-25°C)

  • Inclusion of solubilizing agents or fusion partners to enhance folding

  • Use of specialized membrane protein expression vectors

The addition of an N-terminal His tag has been successfully applied for purification purposes without compromising protein integrity . Expression regions typically encompass the full-length protein (amino acids 1-157) .

What purification strategies are most effective for recombinant yjjB?

Given that yjjB is a membrane protein, effective purification involves:

  • Membrane isolation through differential centrifugation

  • Solubilization using appropriate detergents (e.g., DDM, LDAO, or CHAPS)

  • Affinity chromatography using the N-terminal His tag

  • Size exclusion chromatography for further purification and buffer exchange

For storage, a Tris-based buffer containing 50% glycerol has been shown to maintain protein stability . Alternatively, a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has also been used effectively . The purified protein can achieve greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage conditions for maintaining yjjB protein stability?

For optimal stability of recombinant yjjB protein, the following storage conditions are recommended:

  • Short-term storage (up to one week): 4°C in working aliquots

  • Medium-term storage: -20°C in storage buffer containing 50% glycerol

  • Long-term storage: -80°C in either glycerol or trehalose-containing buffer

Important precautions include:

  • Avoiding repeated freeze-thaw cycles, which can lead to protein degradation and loss of activity

  • Aliquoting the protein solution immediately after purification

  • When using lyophilized powder formulations, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of 5-50% glycerol (final concentration) for storage

How can researchers design experiments to investigate potential functions of yjjB?

To systematically investigate yjjB function, researchers should consider a multi-faceted approach:

  • Genetic approaches:

    • Gene deletion studies to assess phenotypic changes

    • Complementation assays to confirm phenotype specificity

    • Site-directed mutagenesis of conserved residues

  • Biochemical approaches:

    • Protein-protein interaction studies (pull-downs, crosslinking)

    • Lipid binding assays to examine membrane interactions

    • Transport/permeability assays if a transporter function is suspected

  • Structural approaches:

    • Circular dichroism to assess secondary structure

    • Crystallization trials or cryo-EM for high-resolution structure determination

    • Molecular dynamics simulations based on homology models

  • System-level approaches:

    • Transcriptomic profiling of yjjB knockout strains

    • Metabolomic analysis to identify affected pathways

    • Phenotypic microarrays to assess growth under diverse conditions

How does the subcellular localization of yjjB influence experimental design?

The subcellular localization of yjjB as an integral membrane protein has significant implications for experimental design:

  • For interaction studies:

    • Membrane-specific yeast two-hybrid systems should be employed

    • In vivo crosslinking approaches may be more effective than standard co-immunoprecipitation

    • Detergent selection is critical for maintaining native interactions

  • For functional assays:

    • Membrane vesicle preparations may be required for transport assays

    • Proteoliposome reconstitution can provide a controlled environment

    • Fluorescent protein fusions should be designed to avoid disrupting membrane topology

A comparative analysis with other integral membrane proteins from the UPF0442 family can provide valuable insights into conserved structural features and potential functional mechanisms .

What bioinformatic approaches can help predict yjjB function?

Given the limited functional characterization, bioinformatic approaches are valuable for generating testable hypotheses:

  • Structural predictions:

    • Transmembrane topology prediction (TMHMM, TOPCONS)

    • Homology modeling based on structurally characterized membrane proteins

    • Molecular dynamics simulations to assess potential conformational changes

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolved genes

    • Synteny analysis to examine genomic context across species

    • Selection pressure analysis to identify functionally important residues

  • Network-based approaches:

    • Guilt-by-association methods using known protein-protein interaction networks

    • Pathway enrichment analysis of co-expressed genes

    • Text mining of literature for related proteins

What are common issues with recombinant yjjB expression and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant yjjB protein:

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Consider fusion partners that enhance membrane protein expression

    • Evaluate expression in specialized membrane protein expression strains

  • Protein aggregation:

    • Screen multiple detergents for solubilization

    • Optimize protein-to-detergent ratios

    • Reduce expression temperature to slow folding and insertion

    • Add specific lipids that might stabilize the native conformation

  • Protein degradation:

    • Include protease inhibitors throughout purification

    • Minimize time between cell disruption and purification

    • Optimize buffer conditions (pH, ionic strength, additives)

    • Consider expressing in protease-deficient strains

Small volumes of yjjB recombinant protein may occasionally become entrapped in the seal of the product vial during shipment and storage , which can be addressed by brief centrifugation prior to opening.

How can contradictory results in yjjB research be reconciled?

When confronted with contradictory results in yjjB research, consider:

How does yjjB compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis of yjjB with homologs in other bacterial species reveals important evolutionary relationships:

  • Sequence comparison table of selected UPF0442 family proteins:

OrganismProtein AccessionSequence Identity to S. agona yjjBPredicted Transmembrane Domains
Salmonella agonaB5F504100%5-6
Salmonella schwarzengrundB4TU22100%5-6
E. coliP0ADD4/P18389~85%5-6
  • Functional implications:

    • The perfect conservation between Salmonella species suggests critical functional importance

    • The high similarity to E. coli homologs indicates conserved functions across Enterobacteriaceae

    • Differences in specific residues may reflect adaptations to distinct ecological niches

  • Evolutionary context:

    • The UPF0442 family appears widely distributed among Gram-negative bacteria

    • Conservation patterns suggest emergence before the divergence of major enterobacterial lineages

    • Consistent membrane localization points to roles in membrane-associated processes

What are the potential roles of yjjB in Salmonella pathogenesis?

While direct evidence for yjjB's role in pathogenesis is limited, several lines of investigation may prove fruitful:

  • Comparative studies with virulence-associated membrane proteins:

    • Analyze expression patterns during infection models

    • Assess yjjB knockout effects on virulence phenotypes

    • Examine potential interactions with known virulence factors

  • Host-pathogen interaction studies:

    • Investigate changes in yjjB expression during host cell interaction

    • Assess potential roles in antibiotic resistance or stress responses

    • Evaluate contribution to biofilm formation or persistent infection

The consistent conservation of yjjB across Salmonella species suggests it may play a role in core cellular processes that indirectly support pathogenesis, even if not directly involved in virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.