Recombinant Salmonella agona Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Zinc Homeostasis

ZntB mediates zinc efflux, critical for detoxifying excess Zn²⁺ and Cd²⁺ . Key findings include:

  • Phenotypic Analysis: zntB mutants exhibit hypersensitivity to Zn²⁺ (half-maximal growth at 20 μM vs. 60 μM in wild-type) .

  • Transport Activity: Complementation with wild-type zntB restores zinc resistance and efflux capacity .

  • Substrate Specificity: Preferentially transports Zn²⁺ over Cd²⁺, as Cd²⁺ resistance is not restored in complemented mutants .

Table 2: Experimental Evidence for ZntB Functionality

ExperimentOutcomeSource
Growth in Zn²⁺-Rich MediazntB mutants show reduced growth at 20 μM Zn²⁺ vs. wild-type
65Zn²⁺ Efflux AssaysZntB overexpression in E. coli increases efflux by 8.8-fold
CrystallographyPentameric structure with cylindrical pore for Zn²⁺ efflux

Biochemical and Biophysical Properties

  • Homology: Shares structural similarity with CorA Mg²⁺ transporters but lacks Mg²⁺ transport activity .

  • Oligomeric State: Forms homopentamers in solution, distinct from CorA’s trimeric structure .

  • Membrane Topology: Confirmed via deletion analysis and β-galactosidase/β-lactamase fusions .

Table 3: Comparative Analysis of ZntB and CorA

FeatureZntB (Zn²⁺ Efflux)CorA (Mg²⁺ Transport)
SubstrateZn²⁺, Cd²⁺Mg²²⁺
OligomerizationPentamericTrimeric
Pore StructureCylindricalTapered
Functional RoleEfflux (detoxification)Influx/efflux (homeostasis)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; SeAg_B1496; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ZntB protein and what is its primary function?

ZntB is a zinc transport protein encoded by the zntB locus in Salmonella enterica and related enteric bacteria. While structurally related to the CorA family of magnesium transporters, ZntB specifically functions as a zinc efflux pathway . The protein plays a critical role in zinc homeostasis by exporting excess zinc from bacterial cells, thereby preventing zinc toxicity. Mutations in the zntB gene confer increased sensitivity to the cytotoxic effects of zinc (Zn²⁺) and cadmium (Cd²⁺), supporting its role in zinc efflux rather than uptake . This transporter represents a novel function within the ubiquitous CorA family of cation transporters.

How is ZntB structurally related to other transport proteins?

ZntB is homologous to the CorA family of Mg²⁺ transport proteins but has evolved a distinct functional role. The protein contains characteristic structural elements of the CorA family while maintaining specificity for zinc transport . Structural studies comparing full-length Escherichia coli ZntB with the soluble domain of Salmonella typhimurium ZntB reveal significant differences in electrostatic surface potentials between conformational states . The cytoplasmic domain of full-length E. coli ZntB displays a strong positive electrostatic surface potential, contrasting with the negative potential observed in the isolated domain of S. typhimurium ZntB . These differences likely reflect conformational changes associated with the transport mechanism.

How does the transport mechanism of ZntB differ from other CorA family transporters?

Unlike CorA, which functions primarily as a magnesium influx pathway (responsible for >95% of magnesium accumulation under normal growth conditions in S. enterica and E. coli), ZntB specifically mediates zinc efflux and cannot function as a magnesium uptake system . The transport mechanism appears to involve proton-driven zinc transport, as evidenced by transport assays and structural studies .

The conformational changes between zinc-free and zinc-bound states reveal dramatic differences in the electrostatic surface potentials and internal pore shapes, suggesting a mechanism involving helical rotation of transmembrane helix 1 (TM1), which contains conserved basic and acidic residues on adjacent faces . This rotation likely alters the charge distribution in the pore, facilitating zinc transport against its concentration gradient by coupling to proton movement.

What experimental evidence supports the zinc efflux function of ZntB?

Multiple lines of evidence confirm ZntB's role in zinc efflux:

  • Phenotypic analysis: zntB mutations render bacterial cells hypersensitive to zinc toxicity, consistent with impaired efflux capacity .

  • Direct transport measurements: Radiolabeled ⁶⁵Zn²⁺ transport assays demonstrate that zntB mutations specifically diminish zinc efflux capacity without significantly affecting uptake .

  • Complementation studies: The transport deficiency in zntB mutants can be reversed by introducing a plasmid encoding a wild-type zntB allele, confirming the specific role of this protein in zinc transport .

  • Proton-coupled transport: Fluorescence-based assays using the pH-sensitive dye ACMA (9-amino-6-chloro-2-methoxyacridine) demonstrate proton movement coupled to zinc transport, indicating an energetically favorable mechanism for zinc efflux .

How do conformational changes in ZntB facilitate zinc transport?

Structural comparisons between the full-length E. coli ZntB (zinc-free state) and the soluble domain of S. typhimurium ZntB (zinc-bound state) reveal significant conformational differences that likely represent different states in the transport cycle . Key differences include:

  • Charge inversion of the pore surface between the two symmetrical states, possibly caused by helical rotation of TM1, which contains highly conserved basic and acidic residues on adjacent helix faces .

  • Different internal pore shapes between the two forms, likely representing distinct conformational states in the transport cycle .

  • Dramatic differences in electrostatic surface potentials, with the cytoplasmic domain of full-length E. coli ZntB showing strong positive potential and the isolated domain of S. typhimurium ZntB displaying negative potential .

These structural changes likely create a pathway for zinc transport through the symmetrical scaffold of the protein complex.

What are the optimal conditions for expression and purification of recombinant ZntB?

Based on established protocols, the following approach is recommended for optimal expression and purification of recombinant ZntB :

Expression:

  • Use E. coli BL-21(DE3) cells transformed with an appropriate expression vector (e.g., pNIC28-Bsa4 containing the zntB gene).

  • Grow cells in LB medium supplemented with appropriate antibiotics (e.g., 50 μg/ml kanamycin and 34 μg/ml chloramphenicol) at 37°C.

  • Induce protein expression at OD₆₀₀ of 0.8 with 0.1 mM IPTG.

  • Continue expression for 3 hours at 37°C.

Purification:

  • Harvest cells by centrifugation and resuspend in buffer containing 50 mM Tris/HCl pH 8.0, 150 mM NaCl, 10 mM imidazole, and 10% glycerol.

  • Prepare membrane vesicles and solubilize with 1% n-dodecyl-β-D-maltopyranoside (DDM).

  • Purify using Ni²⁺-sepharose affinity chromatography with:

    • Washing buffer: 50 mM Tris/HCl pH 8.0, 150 mM NaCl, 15 mM imidazole, 0.03% DDM

    • Elution buffer: 50 mM Tris/HCl pH 8.0, 250 mM NaCl, 500 mM imidazole, 0.03% DDM

  • Treat with EDTA (2 mM) to remove co-eluted Ni²⁺ ions and residual zinc.

  • Further purify using size-exclusion chromatography with buffer containing 50 mM Tris/HCl pH 8.0, 250 mM NaCl, 0.03% DDM.

How can researchers prepare proteoliposomes for ZntB transport studies?

Preparation of proteoliposomes for functional transport studies of ZntB involves the following methodology :

  • Reconstitution process:

    • Mix purified ZntB with E. coli polar lipids and egg phosphatidylcholine (3:1 w/w ratio) at protein-to-lipid ratio of 1:250.

    • Destabilize preformed liposomes with Triton X-100.

    • Add purified protein and incubate for 30 minutes at room temperature.

    • Remove detergent using Bio-Beads SM-2 over 3-4 hours at 4°C.

    • Collect proteoliposomes by ultracentrifugation and resuspend in appropriate buffer.

  • Buffer preparation for different assays:

    • For zinc transport: Use buffer containing 5 mM HEPES at pH 6.7.

    • For proton transport: Exchange lumenal buffer of proteoliposomes for 5 mM HEPES pH 6.7 using freeze-thaw cycles and extrusion.

  • Proteoliposome treatment before assays:

    • Thaw proteoliposomes and extrude through 400-nm pore size polycarbonate filter (9 passages).

    • For some experiments, treat with ProTev Plus to remove tags.

    • Collect proteoliposomes by ultracentrifugation and resuspend to final concentration of 0.5 μg/μl ZntB.

What methods can be used to measure ZntB transport activity?

Several complementary approaches can be employed to measure ZntB transport activity :

  • Radiolabeled ⁶⁵Zn²⁺ transport assay:

    • Prepare reaction mixture with appropriate buffer containing 22 μM of ⁶⁵ZnCl₂.

    • Initiate transport by adding ZntB-containing proteoliposomes (1 μg of protein).

    • Stop reaction at desired time points with ice-cold buffer.

    • Filter rapidly over nitrocellulose filter and wash.

    • Measure radioactivity using a gamma counter.

  • Proton transport assays:

    • Prepare proteoliposomes with specific internal pH (e.g., pH 6.7).

    • Dilute proteoliposomes in buffer containing the pH-sensitive fluorescent dye ACMA (150 nM).

    • Monitor fluorescence using excitation at 419 nm and emission at 483 nm.

    • Add zinc after equilibration and measure fluorescence changes indicating proton transport.

    • Run parallel controls with empty liposomes.

  • Isothermal titration calorimetry (ITC):

    • Fill ITC cell with purified ZntB (10-15 μM) in appropriate buffer.

    • Titrate substrates into the cell at fixed temperature (25°C).

    • Analyze binding data using appropriate software to determine thermodynamic parameters.

These methods provide complementary information about transport kinetics, energetics, and substrate specificity.

How do mutations in ZntB affect zinc transport and bacterial zinc tolerance?

Mutations in the zntB gene have significant effects on bacterial zinc handling :

  • Zinc sensitivity: zntB mutations confer increased sensitivity to zinc toxicity, as evidenced by disk diffusion assays and growth characterization in zinc-supplemented media .

  • Transport capacity: Direct transport measurements show that zntB mutations specifically reduce zinc efflux capacity without significantly affecting zinc uptake mechanisms .

  • Complementation: The zinc-sensitive phenotype and transport deficiency can be complemented by introducing a plasmid encoding wild-type zntB, confirming the specific role of this protein in zinc tolerance .

  • Cadmium sensitivity: Interestingly, zntB mutations also increase sensitivity to cadmium (Cd²⁺), suggesting that ZntB can transport this toxic heavy metal as well, potentially serving as a detoxification mechanism .

Researchers can use site-directed mutagenesis to target specific conserved residues in ZntB, particularly those in transmembrane helix 1 (TM1) that contain patches of conserved basic and acidic residues implicated in the transport mechanism .

How does ZntB structure compare between different bacterial species?

ZntB proteins show considerable conservation across bacterial species while maintaining their specialized function :

These comparisons provide insights into the evolutionary conservation of this important transport system across bacterial species.

What is the relationship between ZntB structure and its transport mechanism?

The structure-function relationship in ZntB involves several key elements :

  • Pentameric assembly: ZntB forms a homopentameric complex similar to other CorA family transporters, creating a central pore for ion conduction.

  • Transmembrane domains: The transmembrane region contains critical helices, particularly TM1 with its conserved basic and acidic residues that likely undergo rotation during the transport cycle .

  • Cytoplasmic funnel: The large cytoplasmic domain forms a funnel-like structure that likely serves as the initial binding site for zinc ions before transport through the membrane pore.

  • Conformational changes: Comparison of zinc-free and zinc-bound structures reveals significant conformational differences, including:

    • Altered electrostatic surface potentials

    • Different internal pore shapes

    • Changes in the orientation of key helices

  • Proton coupling: Evidence suggests that zinc transport is coupled to proton movement, providing the energy needed for active transport. This coupling likely involves conformational changes triggered by proton binding/release at key residues .

Understanding these structural elements and their dynamic changes is essential for elucidating the complete transport mechanism of ZntB.

What are the optimal storage conditions for purified recombinant ZntB protein?

For maximum stability and activity of purified recombinant ZntB protein, the following storage conditions are recommended :

  • Short-term storage: For working aliquots, store at 4°C for up to one week.

  • Long-term storage: Store at -20°C or preferably -80°C with proper aliquoting to minimize freeze-thaw cycles.

  • Storage buffer: Use Tris/PBS-based buffer with pH 8.0, supplemented with 6% trehalose to enhance stability during freeze-thaw cycles .

  • Glycerol addition: Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage at -20°C/-80°C .

  • Aliquoting: Divide the purified protein into small working aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity.

How should researchers reconstitute lyophilized ZntB protein for experimental use?

Proper reconstitution of lyophilized ZntB protein is critical for maintaining its structure and function :

  • Initial preparation: Briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitution solution: Use deionized sterile water for reconstitution, aiming for a final protein concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add glycerol to a final concentration of 5-50% for stability if the protein will be stored after reconstitution.

  • Handling: Gently mix by inversion rather than vortexing to avoid protein denaturation.

  • Quality control: Verify protein integrity using SDS-PAGE before experimental use; recombinant ZntB should show >90% purity .

  • EDTA treatment: Consider adding EDTA (1-2 mM) to remove any contaminating divalent cations that might affect zinc-binding studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.