Recombinant Salmonella arizonae 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Salmonella arizonae 4-hydroxybenzoate octaprenyltransferase (UbiA) is a membrane-bound enzyme encoded by the ubiA gene. It catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate (4-HB), forming 3-octaprenyl-4-hydroxybenzoate, a critical step in ubiquinone (coenzyme Q) biosynthesis . Ubiquinone is essential for electron transport in aerobic respiration and serves as a lipid-soluble antioxidant .

Catalytic Mechanism

UbiA transfers the octaprenyl group from octaprenyl pyrophosphate (OPP) to 4-HB via a Mg²⁺-dependent reaction, releasing pyrophosphate . This reaction occurs within the lipid bilayer, enabling the synthesis of hydrophobic intermediates in ubiquinone biosynthesis .

  • Repeated freeze-thaw cycles degrade activity; working aliquots are stable at 4°C for ≤1 week .

  • Glycerol (5–50%) is recommended for long-term storage .

Ubiquinone Biosynthesis Studies

  • UbiA is a target for small-molecule inhibitors like 3,6-dihydroxy-1,2-benzisoxazole (DHB), which competes with 4-HB for binding .

  • Mutations in ubiA homologs (e.g., aarE in Providencia stuartii) impair ubiquinone production, leading to defects in electron transport and aminoglycoside resistance .

Key Research Findings

StudyKey InsightImplicationSource
Enzyme InhibitionDHB mimics 4-HB, competitively inhibiting UbiA and blocking ubiquinone synthesis .Potential for novel antibiotics targeting UbiA.
Genetic AnalysisubiA mutations reduce aac(2')-Ia mRNA levels, linking ubiquinone to gene regulation .Connects metabolism to antibiotic resistance.
Phylogenetic ConservationUbiA homologs maintain conserved motifs across bacteria, archaea, and eukarya .Highlights evolutionary importance.

Clinical and Industrial Relevance

  • Antibiotic Development: UbiA’s role in bacterial respiration makes it a target for compounds like DHB, which exhibit species-specific activity .

  • Disease Models: Mutations in human UBIAD1 cause Schnyder corneal dystrophy, providing insights into UbiA-related pathologies .

Future Directions

  • Structural Studies: High-resolution cryo-EM of Salmonella arizonae UbiA could elucidate substrate-binding dynamics.

  • Drug Screening: Optimizing DHB-like inhibitors for enhanced specificity against pathogenic Salmonella strains.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
ubiA; SARI_03444; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVMTLNVMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDKLIIGILQLGVMALMALIGWLNGLGGGYY WAVLVAGALFAYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella arizonae and why is it significant for evolutionary studies?

Salmonella arizonae (also called Salmonella subgroup IIIa) is a Gram-negative, non-spore-forming, motile, rod-shaped, facultatively anaerobic bacterium that occupies an evolutionary position between Salmonella subgroup I (human pathogens) and subgroup V (S. bongori; usually non-pathogenic to humans). This intermediate evolutionary position makes S. arizonae an ideal model organism for studying bacterial evolution from non-human pathogen to human pathogens. Genomic studies of S. arizonae provide crucial insights into evolutionary transitions in Salmonella adaptation from cold-blooded to warm-blooded hosts .

What is the function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in bacterial metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) is an essential enzyme in the ubiquinone (coenzyme Q) biosynthesis pathway. It catalyzes the transfer of a prenyl group to 4-hydroxybenzoate, which represents a critical step in ubiquinone production. This enzyme belongs to the EC class 2.5.1.- (transferases) and is sometimes referred to as 4-HB polyprenyltransferase . Ubiquinone is vital for bacterial respiration and energy production, making ubiA an important enzyme for bacterial survival and potentially an attractive target for antimicrobial development.

How does the genomic context of ubiA in S. arizonae compare to other Salmonella species?

While specific information about ubiA in S. arizonae is limited in the provided search results, comparative genomic analysis between S. arizonae RKS2983, S. bongori NCTC 12419, and S. typhimurium LT2 revealed that S. arizonae contains 926 genes specific to the species that are not found in the other two genomes . Additionally, 516 genes are common to S. arizonae and S. typhimurium LT2 but absent in S. bongori, while another 2823 genes are common to all three genomes . A comprehensive genomic analysis of ubiA across these species would involve identifying the gene in each genome and examining sequence conservation, genetic neighborhood, and potential regulatory elements.

What expression systems are most effective for producing recombinant Salmonella arizonae ubiA?

Based on approaches used for similar membrane-associated proteins, the following expression systems and strategies are recommended:

Table 1: Recommended Expression Systems for Recombinant ubiA

When expressing ubiA, researchers should optimize several parameters:

  • Induction temperature (typically 16-25°C for membrane proteins)

  • Inducer concentration (0.1-1.0 mM IPTG for T7 systems)

  • Expression time (4-24 hours depending on system)

  • Media composition (rich media like TB or minimal media depending on experimental needs)

What are optimal storage conditions for maintaining stability of purified recombinant ubiA?

Based on information from similar proteins like Salmonella schwarzengrund ubiA, recommended storage conditions include:

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Temperature: Store at -20°C for routine storage, or at -80°C for extended preservation

  • Handling: Avoid repeated freeze-thaw cycles as they can lead to protein denaturation

  • Working aliquots: Store at 4°C for up to one week

  • Additives: Consider including reducing agents (DTT or β-mercaptoethanol) if the protein contains cysteine residues

What experimental design strategies are most appropriate for characterizing the enzymatic activity of recombinant ubiA?

A robust experimental design for characterizing ubiA should include:

  • Control Group vs. Experimental Group: Implement true experimental design with appropriate controls, including negative controls (heat-inactivated enzyme) and positive controls (known active enzyme)

  • Variable Manipulation: Systematically vary parameters such as:

    • Substrate concentrations (4-hydroxybenzoate and prenyl donor)

    • pH (typically pH 6.0-9.0 in 0.5 unit increments)

    • Temperature (25-45°C in 5°C increments)

    • Divalent cation concentrations (0-10 mM Mg²⁺, Mn²⁺, or Ca²⁺)

  • Random Distribution of Variables: Ensure randomization in experimental setup to control for extraneous variables and avoid systematic bias

  • Measurement Methods:

    • HPLC or LC-MS to detect and quantify reaction products

    • Spectrophotometric assays if coupled reactions can be designed

    • Radioactive assays using labeled substrates for high sensitivity

How can researchers analyze the kinetic parameters of recombinant ubiA?

Analyzing kinetic parameters of ubiA involves several methodological approaches:

Table 2: Kinetic Analysis Methods for ubiA Characterization

Analysis MethodApplicationData Interpretation
Michaelis-MentenDetermination of Km and VmaxPlot reaction velocity vs. substrate concentration; fit to Michaelis-Menten equation
Lineweaver-BurkAlternative linearization for Km and VmaxPlot 1/v vs. 1/[S]; interpret intercepts and slope
Eadie-HofsteeDetection of cooperative bindingPlot v vs. v/[S]; deviations from linearity indicate cooperativity
Inhibition studiesCharacterization of inhibition mechanismsCompare kinetic parameters with/without inhibitors

For bisubstrate reactions (which ubiA catalyzes), researchers should:

  • Vary one substrate while keeping the other fixed at different concentrations

  • Create double-reciprocal plots to determine reaction mechanism (sequential vs. ping-pong)

  • Calculate true kinetic constants by extrapolation to infinite concentration of the fixed substrate

What structural analysis methods can provide insights into ubiA function?

Structural characterization of ubiA can be approached through multiple methods:

  • Prediction-based approaches:

    • Homology modeling based on crystal structures of related enzymes

    • Transmembrane topology prediction using algorithms like TMHMM or Phobius

    • Molecular dynamics simulations to predict conformational changes

  • Experimental structure determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly powerful for membrane proteins)

    • NMR spectroscopy for specific domains or in detergent micelles

  • Structure-function validation:

    • Site-directed mutagenesis of predicted catalytic residues

    • Chimeric protein construction with other ubiA homologs

    • Correlation of structural predictions with enzymatic activity

How can researchers resolve contradictory data regarding ubiA activity or function?

When faced with contradictory data about ubiA function, researchers should implement the following methodological approach:

  • Systematic experimental design:

    • Use one-group pretest-posttest design for initial troubleshooting

    • Progress to true experimental design with control and experimental groups

    • Implement blinding where appropriate to avoid expectation bias

  • Controlled variable analysis:

    • Isolate and test one variable at a time while keeping others constant

    • Create a matrix of experimental conditions to identify interaction effects

    • Document all experimental parameters meticulously

  • Statistical analysis:

    • Determine appropriate sample sizes through power analysis

    • Apply rigorous statistical tests appropriate for the data distribution

    • Consider Bayesian methods for integrating contradictory data points

  • Reproducibility validation:

    • Verify results across different protein preparations

    • Test in different laboratory environments or with different researchers

    • Compare results using multiple analytical techniques

How can comparative genomics of ubiA inform our understanding of Salmonella evolution?

Comparative genomic analysis of ubiA across Salmonella species can provide valuable evolutionary insights:

  • Sequence conservation analysis:

    • Multiple sequence alignment of ubiA sequences from different Salmonella species

    • Identification of conserved catalytic residues versus variable regions

    • Calculation of nonsynonymous/synonymous substitution ratios to detect selective pressure

  • Phylogenetic analysis:

    • Construction of phylogenetic trees based on ubiA sequences

    • Comparison with species trees to detect horizontal gene transfer events

    • Correlation of sequence variations with host range or environmental adaptation

  • Genomic context comparison:

    • Analysis of gene neighborhood conservation across species

    • Identification of co-evolved genes or operons

    • Detection of genomic islands or mobile genetic elements associated with ubiA variants

S. arizonae's position between human-pathogenic and non-pathogenic Salmonella makes it particularly valuable for such evolutionary studies .

What genomic sequencing and analysis methods are recommended for characterizing the ubiA gene in Salmonella strains?

For comprehensive genomic analysis of ubiA in Salmonella strains, the following methodology is recommended:

  • Sequencing approach:

    • Combine multiple sequencing platforms (Illumina paired-end and long-read technologies)

    • For Illumina sequencing, use paired-end strategy (2×100 bp)

    • Consider mate-pair strategy (2×50 bp) for resolving complex regions

  • Assembly and annotation:

    • Assemble using specialized software like SOAPdenovo, Velvet, or SPAdes

    • Close gaps between contigs using PCR amplification and Sanger sequencing

    • Annotate genes using a combination of ab initio gene prediction and homology-based methods

  • Comparative analysis:

    • Identify ubiA homologs across sequenced Salmonella genomes

    • Compare genomic regions containing ubiA to detect genomic rearrangements

    • Analyze promoter regions to identify potential regulatory elements

Table 3: Genomic Analysis Tools for ubiA Characterization

Analysis TypeRecommended ToolsApplication
Genome assemblySOAPdenovo, Velvet De novo assembly of sequencing reads
Gap closurePCR amplification, ABI3730 sequencer Resolving gaps between contigs
Gene predictionProdigal, GLIMMERIdentifying coding sequences
Homology searchBLAST, HMMERFinding ubiA homologs
Multiple sequence alignmentMUSCLE, MAFFTAligning ubiA sequences for comparison
Phylogenetic analysisRAxML, IQ-TREEConstructing evolutionary trees

How can structural insights into ubiA contribute to antimicrobial drug development?

Understanding the structure of ubiA can facilitate antimicrobial development through several approaches:

  • Structure-based drug design:

    • Identification of substrate binding pockets and catalytic sites

    • Virtual screening of compound libraries against the active site

    • Fragment-based drug discovery to identify lead compounds

    • Rational design of transition-state analogs as potential inhibitors

  • Selectivity analysis:

    • Comparison with mammalian homologs to identify bacterial-specific features

    • Design of selective inhibitors that target bacterial but not host enzymes

    • Analysis of structural differences between ubiA from different bacterial species

  • Resistance mechanism prediction:

    • Identification of potential resistance mutations based on structural analysis

    • Design of inhibitors that maintain efficacy against predicted resistant variants

    • Development of combination approaches targeting multiple sites

What are the most promising experimental approaches for studying ubiA's role in Salmonella virulence and host adaptation?

To investigate ubiA's role in virulence and host adaptation, researchers should consider:

  • Genetic manipulation approaches:

    • Construction of ubiA knockout mutants using CRISPR-Cas9 or traditional methods

    • Complementation studies with ubiA variants from different Salmonella species

    • Controlled expression systems to modulate ubiA levels

  • Infection models:

    • Cell culture infection assays with various host cell types

    • Animal infection models with wild-type and ubiA-modified strains

    • Competition assays between different strains to assess fitness

  • Multi-omics integration:

    • Transcriptomic analysis under different infection conditions

    • Metabolomic profiling to assess ubiquinone levels and energy metabolism

    • Proteomics to identify interaction partners and regulatory networks

  • Host response analysis:

    • Immunological responses to wild-type versus ubiA-modified strains

    • Host metabolic changes during infection

    • Tissue-specific adaptations in different host environments

How can unsupervised Bayesian methods improve data analysis in ubiA research?

Unsupervised Bayesian methods offer powerful approaches for analyzing complex datasets in ubiA research:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.