Recombinant Salmonella arizonae Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SARI_01214; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPSPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, producing cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella arizonae and why is it significant for cls research?

Salmonella arizonae is a Gram-negative, non-spore-forming, motile, rod-shaped, facultatively anaerobic bacterium that was isolated from a human in California, USA. Its significance stems from its evolutionary position between Salmonella subgroup I (human pathogens) and subgroup V (S. bongori, typically non-pathogenic to humans), making it an ideal model organism for studying bacterial evolution from non-human to human pathogens . The genomic analysis of S. arizonae allows researchers to understand the acquisition of pathogenicity islands and virulence factors, providing insights into how cardiolipin synthase genes might have evolved alongside these pathogenic capabilities. The complete genome of S. arizonae strain RKS2983 spans 4,574,836 bp and contains 4,203 protein-coding genes, 82 tRNA genes, and 7 rRNA operons .

What are the different types of cardiolipin synthase genes identified in bacteria?

Three distinct cardiolipin synthase genes have been identified in bacterial systems: clsA, clsB, and clsC (previously annotated as ymdC) . Each of these genes encodes enzymes that catalyze the synthesis of cardiolipin but through potentially different mechanisms or with varying efficiencies. When clsA or clsB are overexpressed, significant cardiolipin accumulation can be observed using thin-layer chromatography (TLC) . In contrast, clsC demonstrates comparatively lower in vivo activity, with cardiolipin production only detectable using more sensitive mass spectrometry techniques . This differential activity suggests specialized roles for each cls enzyme within bacterial physiology.

How does the genomic context of cls genes differ in S. arizonae compared to other Salmonella species?

S. arizonae shares certain Salmonella Pathogenicity Islands (SPIs) with S. bongori while sharing others with S. typhimurium or S. typhi . This unique distribution of pathogenicity islands provides opportunities for evolutionary studies about acquisition of virulence factors during the transition of Salmonella from cold-blooded to warm-blooded animal pathogens . Comparative genomic analysis reveals that S. arizonae RKS2983 contains 926 genes that are specific to this organism and not found in related species . Additionally, there are 516 genes common to both S. arizonae RKS2983 and S. typhimurium LT2 that are absent in S. bongori NCTC 12419, which includes SPI-2, a pathogenicity island associated with virulence .

What methodologies are most effective for expressing and purifying recombinant S. arizonae cls proteins?

For effective expression and purification of recombinant S. arizonae cls proteins, researchers should consider a cloning strategy that incorporates ribosome-binding sites into expression vectors such as the arabinose-inducible pBAD30 . Expression can be induced in bacterial cultures grown to stationary phase (A600 of ~2.0) in medium supplemented with appropriate antibiotics and 0.2% arabinose . For optimal expression of clsC, it's crucial to consider its genomic context - the gene is separated by only one base pair from ymdB in the same operon, and co-expression of both proteins results in significantly enhanced cardiolipin production compared to clsC expression alone .

For protein purification, acidic Bligh-Dyer methods can be employed for lipid extraction to assess enzymatic activity . Activity can be analyzed through either TLC or normal phase LC/MS using a quadrupole time-of-flight tandem mass spectrometer . For detecting low levels of cardiolipin production, LC-MRM analysis using a hybrid triple quadrupole linear ion-trap mass spectrometer is recommended for its superior sensitivity .

How can researchers design experiments to determine substrate specificity of S. arizonae cls enzymes?

To determine substrate specificity of S. arizonae cls enzymes, particularly ClsC, researchers should design in vitro assays using synthetic phospholipid substrates with unique acyl chain compositions. The following experimental approach is recommended:

  • Prepare synthetic phospholipids with distinct acyl chains (e.g., phosphatidylglycerol with 12:0/13:0 acyl chains, and potential donor phospholipids like phosphatidylethanolamine or phosphatidic acid with 14:1/17:0 acyl chains) .

  • Set up reaction mixtures containing purified cls enzyme, potential substrates in various combinations, and appropriate buffers.

  • Analyze reaction products using multiple reaction monitoring (MRM) on a triple quadrupole instrument, where the first (Q1) and last (Q3) mass analyzers function as mass filters to ensure detection of only the expected cardiolipin species .

  • For expected cardiolipin formed from PE and PG, look for a doubly charged [M-2H]2– ion at m/z 618.4 in the first mass filter, and fragments at m/z 225.2 (14:1) and 269.2 (17:0) in the last mass filter, corresponding to the acyl chains from the synthetic substrates .

  • Compare signal intensities across different substrate combinations to determine substrate preferences and reaction kinetics.

This approach allows for precise determination of which phospholipids serve as substrates for cls enzymes. For instance, research has shown that ClsC specifically requires both phosphatidylglycerol (PG) and phosphatidylethanolamine (PE) as co-substrates, with a 500-fold increase in signal when both are present compared to other substrate combinations .

What strategies can be employed to resolve contradictory findings in S. arizonae cls research?

Contradictory findings in S. arizonae cls research can be addressed through a systematic approach to data contradiction analysis. Researchers should implement the following strategies:

  • Comprehensive literature review: Systematically document contradictory findings across published studies, noting differences in experimental conditions, bacterial strains, and methodological approaches .

  • Reproducibility studies: Design experiments that specifically test contradictory claims under standardized conditions, ensuring consistent growth phases, media composition, and environmental factors .

  • Multi-omics integration: Combine genomic, transcriptomic, proteomic, and lipidomic approaches to provide a holistic view of cls function and regulation that may reconcile apparent contradictions .

  • Genetic complementation experiments: Utilize multiple deletion mutants (e.g., ΔclsABC) complemented with individual or combined cls genes to assess functional redundancy or specialization .

  • Cross-species comparative analysis: Compare cls function across the Salmonella evolutionary spectrum (from S. bongori to S. typhimurium) to contextualize S. arizonae findings within evolutionary patterns .

When contradictions arise regarding cls activity levels, researchers should employ both TLC and sensitive mass spectrometry techniques, as demonstrated by studies showing that ClsC activity was undetectable by charring TLC plates but was confirmed through MS analysis .

How can researchers create an effective expression system for recombinant S. arizonae cls genes?

Creating an effective expression system for recombinant S. arizonae cls genes requires attention to genetic context and protein co-expression factors. The following methodology is recommended:

  • Operon structure analysis: Before cloning cls genes, analyze their native genomic context. For instance, clsC operates in an operon with ymdB, separated by only one base pair, suggesting functional interdependence .

  • Vector selection: Choose inducible expression vectors such as pBAD30 with arabinose induction capability for controlled expression .

  • Co-expression strategy: Clone complete operons rather than individual genes when appropriate. For clsC, co-expression with ymdB from the same operon results in cardiolipin levels comparable to those achieved with clsA or clsB overexpression .

  • Independent versus coordinated expression: When testing functional relationships, prepare constructs for both coordinated expression (genes in the same vector) and independent expression (genes in different but compatible vectors) to distinguish between translational coupling effects and protein-protein interactions .

  • Validation approach: Confirm successful expression through lipid analysis using both TLC and mass spectrometry, with particular attention to mass spectrometry for low-activity enzymes like ClsC .

What are the most sensitive methods for detecting and quantifying cardiolipin produced by recombinant S. arizonae cls enzymes?

The detection and quantification of cardiolipin, especially when produced at low levels by enzymes like ClsC, requires sophisticated analytical approaches. The following methodological hierarchy is recommended:

  • Primary screening: Thin-layer chromatography (TLC) with charring for visualization of abundant cardiolipin species, suitable for high-activity enzymes like ClsA and ClsB .

  • Intermediate sensitivity: Normal phase LC/MS using a QSTAR XL quadrupole time-of-flight tandem mass spectrometer for improved detection of moderate cardiolipin levels .

  • Highest sensitivity: LC-MRM (Multiple Reaction Monitoring) analysis using a 4000 Q-Trap hybrid triple quadrupole linear ion-trap mass spectrometer equipped with a Turbo V ion source . This approach allows for:

    • Specific targeting of expected cardiolipin species based on mass-to-charge ratios

    • Filtering for characteristic fragment ions corresponding to acyl chains

    • Detection of cardiolipin species even at very low abundance levels

    • Quantification based on signal intensity relative to standards

  • Acidic Bligh-Dyer method: For lipid extraction prior to analysis, ensuring comprehensive recovery of cardiolipin species from complex biological samples .

  • Internal standards: Inclusion of synthetic cardiolipin with known concentration and unique acyl chain composition to enable absolute quantification.

This tiered approach ensures that cardiolipin production can be reliably detected regardless of enzyme activity levels, with the most sensitive methods capable of detecting the low in vivo activity of ClsC that would be missed by conventional techniques .

How can recombinant S. arizonae cls be utilized in developing novel antibacterial strategies?

Recombinant S. arizonae cls enzymes present several opportunities for antibacterial strategy development based on their essential role in bacterial membrane composition and integrity. Potential applications include:

  • Target-based drug discovery: Using purified recombinant cls enzymes for high-throughput screening of small molecule inhibitors that could disrupt cardiolipin synthesis and compromise bacterial membrane integrity .

  • Nano-antibody development: Similar to approaches used for S. arizonae detection, nano-antibodies could be developed against cls enzymes or their products as potential therapeutic agents . The methodology established for developing nano-antibodies against S. arizonae could be adapted for cls-specific applications, including camel immunization, cDNA synthesis, and phage display techniques .

  • Bacterial membrane engineering: Manipulating cls expression could alter membrane composition, potentially increasing susceptibility to existing antibiotics or membrane-disrupting agents .

  • Evolutionary-guided approaches: The unique evolutionary position of S. arizonae between human pathogens and non-pathogens provides insights into potential targets that might be effective against pathogenic Salmonella while minimizing impacts on beneficial bacteria .

  • Combination therapies: Synergistic approaches targeting both cls enzymes and other membrane biosynthesis pathways could overcome redundancy issues, as demonstrated by studies showing continued cardiolipin production even after deletion of two cls genes .

What are the challenges in resolving contradictions between in vitro and in vivo activities of recombinant S. arizonae cls enzymes?

Resolving contradictions between in vitro and in vivo activities of recombinant S. arizonae cls enzymes presents several methodological challenges:

  • Substrate availability: In vitro assays may not accurately reflect the complex phospholipid composition of bacterial membranes, leading to activity discrepancies. Researchers should employ lipidomic approaches to characterize the native lipid environment and reproduce these conditions in vitro .

  • Protein partners: As demonstrated with ClsC and YmdB, functional activity may depend on protein-protein interactions that are not replicated in simplified in vitro systems . Co-immunoprecipitation and bacterial two-hybrid systems can identify potential interacting partners.

  • Post-translational modifications: In vivo activity may be regulated by modifications not present in recombinant systems. Proteomic analysis of native cls enzymes can identify such modifications.

  • Membrane association: cls enzymes function in membrane environments that are difficult to reproduce in vitro. Development of membrane mimetics or nanodiscs containing appropriate phospholipid compositions can provide more physiologically relevant conditions for activity assays .

  • Regulatory effects: Expression of cls genes may be subject to complex regulation that affects activity levels in vivo. Transcriptomic analysis under various conditions can help identify regulatory mechanisms that should be considered when interpreting in vitro results.

Addressing these challenges requires integrated approaches that combine biochemical characterization with systems biology perspectives, potentially resolving contradictions by contextualizing enzymatic activities within the broader physiological framework of bacterial membrane homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.