Recombinant Salmonella arizonae Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Salmonella arizonae cobS is produced in E. coli with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
UniProt IDA9MLS7
Source OrganismSalmonella arizonae
Protein Length247 amino acids (Full-length)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); store at -20°C/-80°C
ReconstitutionRequires deionized sterile water; glycerol (5–50%) recommended for long-term stability

The enzyme’s amino acid sequence includes conserved motifs for nucleotide loop assembly and membrane association .

Functional Role in Cobalamin Biosynthesis

CobS catalyzes the final steps of AdoCbl synthesis by attaching α-ribazole-5′-phosphate to adenosylcobinamide-GDP (AdoCbi-GDP) . This activity is membrane-dependent and conserved across bacteria and archaea . Key enzymatic steps include:

  1. Substrate Binding: CobS binds AdoCbi-GDP (produced by CobU) and α-ribazole-5′-phosphate (produced by CobT) .

  2. Phosphodiester Bond Formation: CobS synthesizes AdoCbl-5′-phosphate, retaining the phosphate group on the ribose moiety .

  3. Dephosphorylation: CobC subsequently removes the phosphate to yield AdoCbl .

In Vitro Activity

  • CobS, combined with CobU and CobT, reconstitutes AdoCbl-5′-phosphate synthesis from AdoCbi, GTP, and 5,6-dimethylbenzimidazole (DMB) .

  • Purified His-tagged CobS exhibits a specific activity of 8–22 nmol/min/mg, confirmed by HPLC and mass spectrometry .

Evolutionary Significance

  • Salmonella arizonae cobS shares homology with Pseudomonas denitrificans CobV, highlighting conserved cobalamin synthesis pathways in Gram-negative bacteria .

  • Genomic comparisons reveal cobS is absent in non-cobalamin-producing Salmonella lineages, underscoring its niche-specific role .

Applications and Implications

  • Biochemical Tool: Recombinant cobS enables rapid synthesis of cobamides with modified lower ligands for studying B₁₂-dependent enzymes .

  • Membrane Biology: CobS’s membrane association provides a model for studying enzyme-lipid interactions in cofactor biosynthesis .

  • Antimicrobial Targets: CobS inhibitors could disrupt cobalamin metabolism in pathogenic Salmonella strains .

Limitations and Future Directions

  • Low Solubility: CobS tends to aggregate in aqueous solutions, complicating structural studies .

  • Unresolved Kinetics: The timing of CobC-mediated dephosphorylation relative to cobS activity remains unclear .

  • Engineering Potential: Directed evolution of cobS could expand its substrate range for industrial B₁₂ production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; SARI_00871; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
cobS
Target Protein Sequence
MSKLFWATLSFISRLPVPSRWAQGLDFEQYSRGIVMFPLIGAILGGLSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPVLAALAAACAAGRGSAALLMYRHRYAREEGLGNVFIGKVSGRQ TCVTLGLAAIITTVLLPGMQGLAAIVITLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Salmonella arizonae* catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella arizonae and why is it significant for cobS research?

Salmonella arizonae (also called Salmonella subgroup IIIa) is a Gram-negative, non-spore-forming, motile, rod-shaped, facultatively anaerobic bacterium. S. arizonae occupies an evolutionarily significant position between Salmonella subgroup I (human pathogens) and subgroup V (S. bongori, usually non-pathogenic to humans), making it an ideal model organism for studies of bacterial evolution from non-human pathogen to human pathogen . This evolutionary positioning makes S. arizonae particularly valuable for studying the evolution of metabolic pathways, including cobalamin synthesis. The strain RKS2983, isolated from a human in California, USA, has been fully sequenced and contains 4,574,836 bp with 4,203 protein-coding genes, providing a comprehensive genomic resource for recombinant protein studies .

What genomic features of S. arizonae are relevant when expressing recombinant cobS?

The S. arizonae RKS2983 genome contains 926 genes specific to this organism when compared to other Salmonella species . When planning recombinant expression of cobS from S. arizonae, researchers should consider:

  • The unique codon usage patterns in S. arizonae that may differ from other expression hosts

  • The G+C content shifts in Salmonella genomes, which are less pronounced in S. arizonae compared to S. enterica

  • The phylogenetic positioning of S. arizonae between Salmonella subgroup I and S. bongori

These genomic features may affect recombinant protein expression efficiency and require codon optimization when expressing S. arizonae cobS in heterologous hosts.

How does S. arizonae taxonomy impact research on its metabolic enzymes?

Recent large-scale genomic analyses have demonstrated that Salmonella species and subspecies are genetically distinct, with Average Nucleotide Identity (ANI) criteria of 95% suitable to distinguish species and 98% to distinguish subspecies . Additionally, there are recommendations for reclassification of S. arizonae as a separate species . This taxonomic positioning impacts research on metabolic enzymes in several ways:

  • Comparative studies of cobS across Salmonella subspecies may reveal evolutionary adaptations

  • Reclassification may affect how researchers cite and catalog S. arizonae cobS in databases

  • Researchers should be aware that standard biochemical analysis does not fully capture the genomic diversity of Salmonella genus, but routine species identification can be achieved with ribosomal Multi-Locus Sequence Typing (rMLST)

What experimental approaches are most effective for expressing recombinant S. arizonae cobS?

While the search results don't specifically address cobS expression, we can apply principles from other Salmonella research:

When expressing recombinant proteins from S. arizonae, researchers at Arizona State University have developed biologically engineered organisms for antigen delivery that could provide methodological insights . Their approach used regulated programmed lysis of recombinant Salmonella in host tissues to release protective antigens, which might be adaptable for controlled release of recombinant enzymes like cobS .

For laboratory expression, a sequential approach is recommended:

  • Amplify the cobS gene from S. arizonae genomic DNA using high-fidelity PCR

  • Clone into expression vectors with appropriate promoters for your host system

  • Transform into expression hosts (E. coli strains like BL21(DE3) or Rosetta for resolving potential codon bias issues)

  • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Confirm protein identity by mass spectrometry and activity assays

How do the structural features of S. arizonae cobS compare with homologous enzymes from other species?

While specific structural information about S. arizonae cobS is not provided in the search results, researchers investigating structural comparisons should consider:

  • Phylogenetic analysis methods using aligned gene sequences with Neighbor-Joining methods based on randomly selected bootstrap replicates, similar to approaches used for other Salmonella genes

  • Comparative sequence analysis using BLAST with parameters set at >70% DNA identity and >0.7 gene length ratio to categorize genes into common genes, as done for comparative genomic studies of Salmonella strains

  • Multiple sequence alignment using MAFFT program followed by phylogenetic tree construction using MEGA software, which has been successfully applied to study the evolutionary relationships between Salmonella subspecies

What are the challenges in purifying active recombinant cobS enzyme from S. arizonae?

Based on research principles for Salmonella proteins:

  • Expression conditions may need careful optimization to prevent formation of inclusion bodies

  • The enzyme may require specific cofactors or metal ions for proper folding and activity

  • Purification strategies should account for potential membrane association or aggregation

  • Activity assays should include controls to distinguish between apo-enzyme and holo-enzyme forms

Researchers should consider using the Miles and Misra method for quantification of bacterial cultures during expression optimization, which has been successfully applied in Salmonella research . This technique involves serial dilutions in sterile PBS, plating 0.02 mL drops onto appropriate media, and counting colonies in areas with 20-100 colonies, with triplicate measurements for statistical reliability .

What cultivation methods are optimal for S. arizonae growth prior to cobS extraction?

For optimal cultivation of S. arizonae:

  • Use brain heart infusion broth (BHI) which has been successfully employed for Salmonella cultivation in experimental studies

  • Incubate at 37°C for 12-24 hours under aerobic conditions

  • For large-scale cultures, consider using modified minimal media supplemented with appropriate growth factors

  • Monitor growth by measuring optical density at 600 nm

  • Harvest cells during late logarithmic phase for optimal protein expression

When scaling up, researchers can adapt the quantification approach used in experimental Salmonella studies: culture in BHI for 12 hours at 37°C, followed by centrifugation and resuspension in phosphate-buffered saline (PBS) at pH 7.3 .

What detection methods can verify successful expression of recombinant S. arizonae cobS?

While specific methods for cobS detection aren't detailed in the search results, researchers can adopt approaches used for other Salmonella proteins:

  • PCR-based detection methods similar to those used for invA gene detection in Salmonella studies

  • The PCR approach should be coupled with bacteriological results to confirm identity

  • Western blotting with antibodies against tagged recombinant protein

  • Activity assays specific to cobalamin biosynthesis pathway enzymes

  • Mass spectrometry to confirm protein identity and modifications

The combined PCR and bacteriological approach has proven effective in experimental Salmonella studies, with PCR enhancing detection sensitivity when culturing methods might miss low concentrations .

How can researchers assess the functional activity of recombinant S. arizonae cobS?

For functional assessment of cobS activity:

  • Develop enzymatic assays specific to the cobalamin synthesis pathway step catalyzed by cobS

  • Compare activity between native and recombinant forms of the enzyme

  • Assess the impact of environmental factors (pH, temperature, salt concentration) on enzyme activity

  • Evaluate the enzyme's substrate specificity and kinetic parameters

  • Consider complementation assays in cobS-deficient bacterial strains to demonstrate functional activity in vivo

How does S. arizonae cobS differ from homologous enzymes in related Salmonella species?

Based on comparative genomic principles applied to Salmonella:

The phylogenetic position of S. arizonae between Salmonella subgroup I and S. bongori provides a unique evolutionary perspective . Core gene analysis has shown that S. arizonae RKS2983 shares 2,823 genes with S. bongori NCTC 12419 and S. typhimurium LT2, while possessing 926 genes specific to its genome . This suggests that metabolic enzymes like cobS may show intermediate evolutionary characteristics between human-pathogenic and non-human-pathogenic Salmonella species.

Researchers should investigate whether cobS falls within:

  • The core 2,823 genes common to all three genomes

  • The 516 genes common to S. arizonae RKS2983 and S. typhimurium LT2 but absent in S. bongori

  • The 926 genes specific to S. arizonae RKS2983

What role might cobS play in the pathogenicity of S. arizonae?

While cobS-specific information is not provided, researchers can consider:

S. arizonae shares some Salmonella pathogenicity islands (SPIs) with S. bongori NCTC 12419 and others with S. typhimurium LT2 or S. typhi Ty2, providing opportunities for evolutionary studies about acquisition of SPIs during transition of Salmonella from cold- to warm-blooded animal pathogens . This positioning makes S. arizonae valuable for understanding the role of metabolic enzymes like cobS in pathogenicity.

Experimental infection studies in animal models, similar to those conducted with S. enterica subsp. diarizonae in lambs , could help determine whether cobalamin synthesis plays a role in S. arizonae virulence. Such studies would need to track bacterial recovery from tissues, histopathological changes, and potential metabolic advantages conferred by functional cobS.

What genomic contexts surround the cobS gene in different Salmonella species?

Researchers investigating the genomic context of cobS should:

  • Compare the arrangement of cobalamin synthesis genes in S. arizonae with other Salmonella species

  • Examine whether cobS is located within any of the Salmonella pathogenicity islands

  • Analyze whether regulatory elements controlling cobS expression differ between species

  • Consider how horizontal gene transfer might have influenced the evolution of the cobalamin synthesis pathway

Table 1. Comparison of Key Features Across Salmonella Species Relevant to Recombinant Protein Research

FeatureS. arizonaeS. bongoriS. enterica subsp. I
Genome size4,574,836 bpVariableVariable
Protein-coding genes4,203FewerMore
Species-specific genes926Variable1,017 (in LT2)
Pathogenicity islandsIntermediateFewerMore complete
Phylogenetic positionBetween subgroups I and VAncestralMore evolved
Host rangeIntermediateLimitedBroad
G+C content shiftLess pronouncedLess pronouncedMore pronounced

How can recombinant S. arizonae cobS be utilized in vaccine development research?

The ASU research on using salmonella to administer vaccines provides insights for potential applications :

Researchers at Arizona State University have developed a biologically engineered organism using live salmonella bacterium as a containment/delivery method for antigens . This approach involves regulated programmed lysis of recombinant Salmonella in host tissues to release protective antigens and confer biological containment . Similar principles could be applied to design recombinant S. arizonae strains expressing modified cobS or other immunogenic proteins for vaccine development.

This approach offers potential advantages for vaccine delivery:

  • Effective delivery of antigens in the body without infecting with salmonella

  • No vaccine cells left in the environment

  • Potential application in those who don't benefit from traditional vaccines due to cost, drug resistance, or limited effects in certain populations

What insights can comparative genomic analysis provide for optimizing recombinant cobS expression?

Based on the comparative genomic analysis described in the search results:

  • Analyze the core gene data of S. arizonae RKS2983, S. bongori NCTC 12419, and S. typhimurium LT2 to understand evolutionary conservation of cobS

  • Use tools like MAFFT for multiple sequence alignment and MEGA software for phylogenetic analysis to determine evolutionary relationships

  • Consider differences in G+C content between Salmonella species that may affect codon optimization strategies for recombinant expression

  • Examine whether cobS falls within the 2,823 genes common to all three genomes or within genes specific to particular Salmonella lineages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.