Recombinant Salmonella arizonae Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Protein Overview

RnfE is a subunit of the electron transport complex in Salmonella arizonae, a subspecies associated with reptilian reservoirs and opportunistic infections in mammals . The recombinant form is expressed in E. coli with an N-terminal His-tag for purification . Key specifications include:

ParameterDetails
Gene NamernfE
UniProt IDA9MEG7
Amino Acid Sequence1-230 residues (Full length)
Expression HostE. coli
Molecular Weight~26 kDa (estimated)
Purity>90% (SDS-PAGE verified)
StorageTris/PBS buffer with 50% glycerol; store at -20°C/-80°C

Functional Role in Bacterial Physiology

RnfE is part of the Rnf (Rhodobacter nitrogen fixation) complex, which facilitates electron transfer across bacterial membranes. This complex is implicated in:

  • Energy conservation via ion gradient generation .

  • Anaerobic respiration, particularly under nitrogen-limiting conditions .

  • Pathogenicity island coordination, though S. arizonae lacks key effectors like sipA and ssaI found in other Salmonella subspecies .

Notably, S. arizonae retains SPI-20, a type VI secretion system exclusive to this subspecies, which may interact with electron transport machinery .

Biotechnological Applications

Recombinant RnfE is utilized in diverse research and industrial contexts:

ApplicationDescriptionSources
Vaccine DevelopmentAntigen candidate for subunit vaccines targeting Salmonella infections
ELISA & ImmunoassaysUsed as a recombinant antigen in diagnostic kits (e.g., CSB-CF431231STE)
Structural StudiesFacilitates crystallography and mutagenesis to map electron transport mechanisms
Comparative GenomicsServes as a marker for evolutionary studies of Salmonella subspecies

Research Findings and Genomic Context

  • Polyphyly in S. arizonae: Whole-genome sequencing reveals that 33% of S. arizonae serovars are polyphyletic, with RnfE conserved across clades despite genomic diversity .

  • Prophage Enrichment: Five novel prophages identified in S. arizonae may influence horizontal gene transfer, including rnf operon components .

  • SPI-20 Conservation: The type VI secretion system (SPI-20) is ubiquitous in S. arizonae and may synergize with Rnf-mediated redox processes .

Limitations and Future Directions

  • Functional Gaps: The exact role of RnfE in S. arizonae pathogenicity remains underexplored compared to homologs in E. coli or S. Typhimurium .

  • Structural Insights: High-resolution structures of the Rnf complex in S. arizonae are needed to elucidate electron transfer mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; SARI_01528; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAVTAPSAVPAGETGKV
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what is its significance in bacterial physiology?

The Rnf complex is a widespread bacterial membrane-bound enzyme complex that plays a critical role in energy conservation across many bacterial species. It functions as a respiratory enzyme that oxidizes reduced ferredoxin (Fdred) and reduces NAD+ (and vice versa), coupled to ion transport across the cytoplasmic membrane. This activity is essential for energy conservation in many bacteria and also drives reverse electron transport for ferredoxin reduction . The Rnf complex is particularly significant because it represents a relatively simple respiratory chain that, when coupled with a Na+-F1F0 ATP synthase, can form a complete two-limb respiratory system, as demonstrated in Thermotoga maritima .

What is the structure and composition of the Rnf complex?

The Rnf complex is composed of six distinct subunits, typically encoded by the rnf genes. Of these subunits, two are predicted to be membrane-integral proteins, while the other four are cytosolic components. Specifically, RnfB is understood to be the entry point for electrons from reduced ferredoxin, while RnfC is believed to contain the NAD binding site . Electron flow within the complex likely proceeds from RnfB to RnfC via RnfA and RnfG. The membrane-integral subunits D and E are thought to be responsible for mediating ion (Na+) transport, which is driven by electron transport involving iron-sulfur clusters, monovalent iron, and covalently bound flavins .

What is known about the RnfE subunit specifically?

RnfE is one of the membrane-integral subunits of the Rnf complex and is believed to be involved in ion (Na+) transport across the cytoplasmic membrane. In Salmonella arizonae (strain ATCC BAA-731/CDC346-86/RSK2980), the RnfE protein is encoded by the rnfE gene (locus name: SARI_01528) and has a specific amino acid sequence that includes regions involved in membrane integration and ion transport functionality . The RnfE subunit contains conserved acidic amino acids that may be candidates for Na+ binding, similar to homologous residues in the related Nqr complex .

How does the ion transport mechanism of the Rnf complex function at the molecular level?

The ion transport mechanism of the Rnf complex appears to be primarily Na+-coupled, as definitively demonstrated through purification and functional reconstitution experiments with the T. maritima Rnf complex. DCCD (dicyclohexylcarbodiimide) has been shown to inhibit the Rnf complex, competing with Na+ for a common binding site, similar to Na+-F1F0 ATP synthases . Conserved acidic amino acids in subunits D and E are potential candidates for Na+ binding sites, including glutamate and aspartate residues that are conserved across different bacterial species .

What differences exist between Rnf complexes from different bacterial species?

One striking difference between Rnf complexes from different bacterial species involves the length of the RnfB subunit, particularly in its C-terminus which harbors iron-sulfur clusters. The number of predicted Fe-S centers varies significantly: Acetobacterium woodii has six predicted FeS centers, Clostridium ljungdahlii has four, while Rhodobacter capsulatus, Vibrio cholerae, and Escherichia coli have two each. In contrast, Thermotoga maritima has only one predicted Fe-S center .

Despite these structural differences, the Rnf complex maintains functional conservation across species, as evidenced by the ability of ferredoxin from Clostridium pasteurianum to deliver electrons to the Rnf complex from T. maritima . This suggests that while structural variations exist, core functional elements are preserved across diverse bacterial species.

What challenges exist in the purification and study of the Rnf complex?

Historically, the Rnf complex has been exceptionally difficult to purify from various bacterial sources, which has hampered detailed biochemical and structural characterization. The breakthrough in purification came with the isolation of the complex from the thermophilic bacterium Thermotoga maritima, suggesting that the thermostable nature of proteins from this organism provided advantages in the purification process .

Even with purified protein, challenges persist in studying the complex at optimal conditions, as auxiliary enzymes required for experimental assays (such as ferredoxin reduction) are often unstable at the high temperatures preferred by thermophilic proteins. This necessitates conducting activity assays under suboptimal temperature conditions, which may affect the interpretation of kinetic and mechanistic data .

What approaches can be used to optimize recombinant expression of RnfE protein?

Optimizing recombinant expression of the RnfE protein can benefit significantly from implementing a Design of Experiments (DoE) approach. Unlike traditional one-factor-at-a-time methods, DoE systematically evaluates how multiple experimental parameters interact to affect protein yield and quality .

A DoE strategy involves defining key factors (such as temperature, pH, dissolved oxygen concentration, induction timing, and media composition) and testing them at different levels using a statistically designed experimental matrix. This approach allows researchers to model the relationship between these factors and the response (protein yield) using a smaller number of experiments than would be required to test all possible combinations .

For membrane proteins like RnfE, special considerations include:

  • Testing expression in specialized host strains designed for membrane protein production

  • Evaluating different detergents for solubilization efficiency

  • Optimizing induction conditions to prevent aggregation

  • Controlling growth rates to allow proper membrane insertion

Software packages such as MiniTab, Modde, ECHIP, and Design-Expert can facilitate the design and analysis of these experiments, enabling iterative optimization through multiple rounds of DoE .

What purification strategies are most effective for RnfE and the Rnf complex?

Based on successful purification of the Rnf complex from Thermotoga maritima, effective purification strategies for RnfE and the complete Rnf complex should consider:

  • Source selection: Thermophilic organisms may provide more stable versions of the complex that better withstand purification procedures .

  • Membrane solubilization: Careful selection of detergents is critical for extracting membrane-integral components like RnfE without disrupting complex integrity.

  • Affinity purification: Adding specific tags (determined during the production process) can facilitate purification while minimizing disruption of function .

  • Storage conditions: The purified protein should be stored in appropriate buffers (such as Tris-based buffer with 50% glycerol) at -20°C or -80°C for extended storage to maintain stability .

  • Functional verification: Following purification, it's essential to verify that the complex maintains its electron transport and ion translocation activities through reconstitution experiments.

How can functional assays be designed to characterize RnfE activity?

Functional characterization of RnfE activity should focus on both its role within the complete Rnf complex and its specific contribution to ion transport. Key functional assays include:

  • Electron transport assays measuring ferredoxin oxidation coupled to NAD+ reduction, which can be monitored spectrophotometrically.

  • Ion transport assays using reconstituted proteoliposomes loaded with fluorescent Na+ indicators to detect Na+ transport driven by the redox reaction.

  • Inhibition studies using DCCD, which competes with Na+ for binding, to identify key functional residues involved in ion transport .

  • Site-directed mutagenesis of conserved acidic residues (potential Na+ binding sites) followed by functional assays to determine their role in ion transport.

  • Thermostability assays to determine optimal temperature ranges for activity, particularly important when working with components from thermophilic organisms like T. maritima.

How can researchers interpret complex data from DoE studies of recombinant RnfE expression?

Interpretation of DoE data for recombinant RnfE expression requires statistical analysis to develop mathematical models that describe the relationship between experimental factors and protein yield. The process typically involves:

  • Fitting response data to appropriate models (linear or non-linear)

  • Quantitatively determining the effect of each factor on the response

  • Identifying significant interactions between factors

  • Assessing model quality through statistical parameters such as R²

  • Analyzing residuals to ensure model validity

Statistical software can generate response surface plots that visually represent how different factors affect protein yield, making it easier to identify optimal conditions. For instance, in a three-factor DoE investigating temperature, pH, and dissolved oxygen effects on protein expression, a well-designed experimental matrix might require only 13 experimental combinations (rather than 27 for all possible combinations) to develop a predictive model .

What analytical approaches help distinguish between functional and non-functional recombinant RnfE?

Distinguishing functional from non-functional recombinant RnfE requires multiple analytical approaches:

  • Structural integrity assessment using circular dichroism spectroscopy to evaluate secondary structure content.

  • Thermal shift assays to determine protein stability and proper folding.

  • Binding assays with known interacting partners (other Rnf complex subunits) to verify correct tertiary structure.

  • Functional reconstitution experiments measuring electron transport activity when combined with other Rnf subunits.

  • Ion transport measurements in proteoliposome systems to verify Na+ pumping activity.

  • Inhibition studies using DCCD to confirm the presence of functional Na+ binding sites characteristic of properly folded RnfE .

What are the optimal storage conditions for recombinant RnfE protein?

The optimal storage conditions for recombinant RnfE protein involve maintaining it in a Tris-based buffer containing 50% glycerol, which helps prevent protein degradation and maintain solubility. The recommended storage temperature is -20°C for routine storage, while -80°C is preferred for extended storage periods .

It's important to note that repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. Instead, preparing small working aliquots and storing them at 4°C for up to one week is recommended for active experimentation periods .

How can researchers address challenges in experimental design when studying membrane proteins like RnfE?

Working with membrane proteins like RnfE presents unique challenges that require specific experimental considerations:

  • Expression systems: Consider specialized expression systems designed for membrane proteins, which provide controlled expression rates and appropriate membrane insertion machinery.

  • Solubilization strategies: Test multiple detergents at various concentrations to identify conditions that efficiently extract RnfE from membranes while preserving its native conformation and activity.

  • Temperature considerations: When working with proteins derived from thermophilic organisms (like the T. maritima Rnf complex), balance the need for protein stability with the limitations of auxiliary enzymes used in activity assays, which may be unstable at high temperatures .

  • Reconstitution methods: Develop appropriate proteoliposome reconstitution protocols that allow for functional studies of ion transport activity in a membrane environment that mimics native conditions.

  • Implementation of DoE: Use statistical experimental design approaches to systematically explore the multidimensional parameter space affecting membrane protein expression, purification, and activity, rather than relying on one-factor-at-a-time optimization .

What are the future research directions for understanding RnfE and the Rnf complex?

Future research on RnfE and the Rnf complex is likely to focus on several key areas:

  • Obtaining high-resolution structural data through techniques such as cryo-electron microscopy or X-ray crystallography to understand the molecular architecture of the complex.

  • Detailed characterization of the ion translocation mechanism, including identification of the specific residues forming the Na+ channel and understanding how electron transport is coupled to ion movement.

  • Comparative studies of Rnf complexes from different bacterial species to understand the functional significance of variations in subunit structure, particularly the different numbers of Fe-S clusters in the RnfB subunit.

  • Investigation of the physiological role of the Rnf complex in diverse bacterial metabolic contexts, including its importance in fermenting bacteria and its potential as a target for antimicrobial development.

  • Engineering of the Rnf complex for biotechnological applications, such as improving fermentation processes or developing bioelectrochemical systems.

These research directions will contribute to a more comprehensive understanding of this important bacterial respiratory enzyme and may lead to novel applications in microbial biotechnology and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.