Recombinant Salmonella arizonae Fumarate reductase subunit D (frdD)

What is Salmonella arizonae fumarate reductase subunit D and its genomic context?

Fumarate reductase subunit D (frdD) is a 13 kDa hydrophobic protein encoded by the frdD gene (SARI_03293) in Salmonella enterica subspecies arizonae. The full-length protein consists of 119 amino acids with the sequence beginning with MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ and continuing through to completion as identified through protein sequencing . This protein functions as part of the fumarate reductase complex, which plays a critical role in anaerobic respiration.

S. arizonae represents one of the 10 known subspecies of Salmonella enterica, a highly diverse species with approximately 2,600 serotypes . The genome of S. arizonae (strain ATCC BAA-731/CDC346-86/RSK2980) has been fully sequenced, allowing for detailed analysis of its metabolic genes including frdD . Unlike S. enterica subspecies enterica, which causes most human salmonellosis cases, S. arizonae is more frequently associated with reptiles as animal reservoirs but can cause illness in mammals including humans .

Methodologically, researchers investigating frdD should consider its genomic context within the Salmonella core genome phylogeny, as whole-genome sequencing analyses have revealed complex evolutionary relationships among Salmonella subspecies, including evidence of recombination events that may have influenced metabolic gene functions .

What is the functional role of fumarate reductase in Salmonella metabolism?

Fumarate reductase plays a crucial role in anaerobic respiration in Salmonella species, functioning as a terminal electron acceptor enzyme when oxygen is unavailable. The enzyme catalyzes the reduction of fumarate to succinate, allowing for continued ATP generation under anaerobic conditions. The frdD subunit specifically serves as an anchor protein that helps stabilize the fumarate reductase complex within the bacterial membrane.

The enzyme complex consists of four subunits (FrdA, FrdB, FrdC, and FrdD) and is particularly important for Salmonella survival in oxygen-limited environments, such as those encountered during host infection or in certain environmental niches. Studies investigating Salmonella metabolism have shown that anaerobic respiration systems, including fumarate reductase, contribute to bacterial fitness during infection and may influence virulence .

For experimental approaches studying fumarate reductase activity, researchers typically employ:

• Anaerobic growth assays with fumarate as the sole electron acceptor

• Enzymatic activity assays measuring the conversion of fumarate to succinate

• Membrane fraction isolation to study the localization and assembly of the complex

How does recombinant frdD protein differ from native frdD in structural and functional properties?

The recombinant Salmonella arizonae frdD protein available for research purposes typically contains specific modifications that facilitate its expression, purification, and experimental manipulation. Key differences include:

Methodologically, when working with recombinant frdD, researchers should consider: (1) the presence and potential influence of any tags used for purification, (2) the proper reconstitution of membrane proteins if necessary, and (3) validation that the recombinant protein maintains native-like function through appropriate activity assays.

What are the optimal conditions for expressing and purifying recombinant S. arizonae frdD?

Expressing membrane proteins like frdD presents specific challenges due to their hydrophobic nature. Based on standard protocols for similar proteins and the specific characteristics of frdD, the following optimized conditions are recommended:

For methodological considerations, researchers should verify protein integrity throughout the purification process using SDS-PAGE and Western blotting. Functional assessment through enzyme activity assays is crucial to confirm that the recombinant protein maintains native-like properties. The full amino acid sequence provided in product information can be used for designing primers and verification strategies .

How can recombinant frdD be used in studies of Salmonella anaerobic respiration and metabolism?

Recombinant frdD provides a valuable tool for investigating Salmonella anaerobic respiration mechanisms through several experimental approaches:

• Reconstitution studies: Purified recombinant frdD can be used in reconstitution experiments with other fumarate reductase subunits to study complex assembly and activity in vitro.

• Interaction analysis: Techniques such as pull-down assays, co-immunoprecipitation, or surface plasmon resonance using recombinant frdD can identify novel protein-protein interactions within the respiratory chain.

• Structure-function relationships: Site-directed mutagenesis of recombinant frdD followed by functional assays helps identify critical residues for membrane anchoring or complex stability.

• Comparative studies: Comparing the properties of frdD from different Salmonella subspecies, including S. arizonae, can provide insights into evolutionary adaptations of anaerobic respiration systems. This is particularly relevant given the evolutionary diversity observed across Salmonella subspecies, with evidence of recombination contributing to their diversification .

• Environmental adaptation studies: Examining how frdD expression and activity respond to different environmental conditions can reveal adaptations to specific niches, such as the reptile hosts typically associated with S. arizonae .

What techniques are most effective for studying interactions between frdD and other subunits of the fumarate reductase complex?

Several complementary techniques can be employed to investigate protein-protein interactions involving frdD:

When employing these techniques with recombinant frdD, researchers should consider the hydrophobic nature of the protein and its natural membrane environment. Using appropriate detergents or membrane mimetics is essential for maintaining the native-like structure of frdD during these studies.

How does frdD in S. arizonae compare to homologs in other Salmonella subspecies and bacterial species?

Comparative genomic analyses reveal interesting evolutionary patterns in frdD across Salmonella:

The evolutionary history of frdD should be interpreted within the broader context of Salmonella evolution. Whole-genome sequencing analyses have revealed that approximately 14.44% of the Salmonella pan-genome shows evidence of recombination, contributing to the tremendous diversity observed across subspecies . While specific information about frdD recombination is not provided in the search results, the gene should be considered within this evolutionary context.

Methodologically, researchers studying frdD evolution should employ phylogenetic analyses incorporating both nucleotide and amino acid sequences, and consider the impact of horizontal gene transfer on metabolic gene evolution in Salmonella.

What role might frdD play in the adaptation of S. arizonae to specific ecological niches?

S. arizonae is frequently associated with reptilian hosts, a distinct ecological niche compared to other Salmonella subspecies . The adaptation to this niche likely involves specialized metabolic capabilities, potentially including modifications to anaerobic respiration systems like fumarate reductase.

Potential adaptations involving frdD may include:

• Temperature adaptation: Modifications to frdD structure or regulation that optimize function at varying temperatures encountered in poikilothermic reptilian hosts.

• Niche-specific metabolism: Adaptations for utilizing fumarate as an electron acceptor under the specific conditions found in reptilian intestinal environments.

• Host-pathogen interactions: Potential involvement in surviving host immune responses specific to reptiles.

• Environmental persistence: Adaptations for survival in environments associated with reptiles, potentially involving anaerobic respiration.

Research approaches to investigate these adaptations include:

• Comparative growth studies under conditions mimicking reptilian hosts

• Expression analysis of frdD under varying environmental conditions

• Construction of frdD mutants and assessment of their fitness in different environments

• Heterologous expression of S. arizonae frdD in other Salmonella subspecies to assess functional differences

How might frdD contribute to S. arizonae pathogenicity in humans and animals?

While fumarate reductase primarily functions in anaerobic respiration, its activity may indirectly influence Salmonella pathogenicity through several mechanisms:

• Survival in oxygen-limited environments: During infection, Salmonella encounters oxygen-limited environments in the host intestine and within macrophages. Fumarate reductase enables anaerobic respiration, potentially contributing to bacterial persistence in these niches.

• Metabolic flexibility: The ability to use alternative electron acceptors like fumarate provides metabolic flexibility that may enhance survival during infection.

• Potential connections to virulence regulation: Metabolic status can influence virulence gene expression through global regulators that respond to environmental conditions.

S. arizonae is known to cause infections in humans, although less frequently than S. enterica subspecies enterica . The contribution of frdD to its pathogenicity should be considered within the broader context of Salmonella pathogenicity islands (SPIs) and virulence mechanisms. Notably, while SPIs 1 and 2 are present across all Salmonella subspecies, including S. arizonae, some effectors appear to be lost in this lineage . Additionally, S. arizonae uniquely possesses SPI-20, which encodes a type VI secretion system .

What experimental systems are most appropriate for studying the role of frdD in virulence?

Several experimental approaches can be used to investigate potential connections between frdD and virulence:

When studying S. arizonae specifically, researchers should consider both mammalian and reptilian infection models to account for the organism's natural host range . The unique genomic features of S. arizonae, including SPI-20 and the absence of certain effectors in SPIs 1 and 2, should be considered when interpreting results related to pathogenicity .

What are common challenges in working with recombinant frdD and how can they be overcome?

Due to its hydrophobic nature and membrane localization, working with frdD presents several technical challenges:

When troubleshooting, researchers should consider that the amino acid sequence of frdD (MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL) indicates a highly hydrophobic protein with multiple transmembrane segments , which requires specialized handling throughout experimental procedures.

What controls should be included when studying recombinant frdD function?

Rigorous experimental design for studies involving recombinant frdD should include multiple controls:

• Negative controls:

  • Empty vector controls for expression studies

  • Heat-inactivated protein for enzyme activity assays

  • Unrelated membrane protein of similar size for specificity tests

• Positive controls:

  • Known functional homolog (e.g., E. coli frdD)

  • Commercially validated fumarate reductase for activity benchmarking

  • Well-characterized membrane protein for purification protocol validation

• Validation controls:

  • Mass spectrometry confirmation of protein identity

  • Circular dichroism to verify proper secondary structure

  • Activity assays with purified complex to confirm functional reconstitution

• Experimental design considerations:

  • Multiple biological replicates (minimum n=3)

  • Technical replicates for each measurement

  • Dose-response relationships where applicable

  • Time-course experiments for kinetic analyses