Recombinant Salmonella arizonae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

  • Gene locus: lspA (SARI_02947) in Salmonella arizonae (strain ATCC BAA-731) .

  • Protein function: Lipoprotein signal peptidase (SPase II; EC 3.4.23.36), responsible for cleaving signal peptides from prolipoproteins during secretion .

  • Domain structure: Contains conserved residues critical for enzymatic activity, including a serine-lysine catalytic dyad common to SPase II enzymes .

Amino Acid Sequence

The full-length recombinant protein (166 residues) includes the following key sequence regions :

PositionSequence SegmentFunctional Annotation
1–30MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNTransmembrane domain
31–90FALGDTVGLFPSLNLHYARNYGAAFSFLADSGGCatalytic core
91–166WQRWFFAGIAIGICVILVAMMYRSKATQKLNNIC-terminal substrate-binding region

Expression System

  • Host: Escherichia coli .

  • Vector: Unspecified, but optimized for secretion into periplasm and supernatant.

  • Tag: Undisclosed affinity tag (determined during production) .

Biophysical Properties

ParameterDetail
Molecular weight~15 kDa (theoretical)
Storage bufferTris-based, 50% glycerol
StabilityStable at -20°C or -80°C; avoid freeze-thaw cycles

Enzymatic Activity

  • Globomycin resistance: Overexpression of S. arizonae lspA in E. coli confers resistance to globomycin, a SPase II inhibitor, confirming functional homology to E. coli SPase II .

  • Complementation assays: Partially restores growth in E. coli SPase II temperature-sensitive mutants, though activity is lower than native E. coli lspA (~20% efficiency) .

Transcriptional Regulation

  • Co-expression with lgt: lspA and lgt (prolipoprotein transferase) show synchronized expression during Salmonella intracellular growth, peaking at 48 hours post-infection .

  • Comparison with lepB: lepB (SPase I) is expressed at higher levels, reflecting its broader role in non-lipoprotein secretion .

Genomic Localization

  • Pathogenicity islands: S. arizonae lacks SPI-1 and SPI-2 effectors but retains SPI-20, a type VI secretion system unique to this subspecies .

  • Conservation: lspA is highly conserved across Salmonella subspecies, with 22% sequence identity to E. coli lspA .

Phylogenetic Significance

  • Horizontal gene transfer: lspA’s functional conservation suggests vertical inheritance, contrasting with polyphyletic serovar distribution in S. arizonae .

Vaccine Development

  • Antigen potential: Lipoproteins processed by lspA are immunogenic; recombinant lspA could serve as a subunit vaccine target, akin to Salmonella InvH protein .

  • Antibiotic discovery: Globomycin resistance assays enable screening for novel SPase II inhibitors .

Diagnostic Tools

  • Antibody generation: Recombinant lspA has been used to develop nano-antibodies for Salmonella detection, though cross-reactivity remains a challenge .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
lspA; SARI_02947; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILVAMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPAAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its function in bacterial physiology?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that plays a critical role in the lipoprotein processing pathway of bacteria. It specifically cleaves the transmembrane helix signal peptide of lipoproteins after they have been lipidated by prolipoprotein diacylglyceryl transferase (Lgt). This processing is essential for proper lipoprotein maturation and localization .

In bacterial physiology, LspA functions as a type II signal peptidase (SPase II) that enables lipoproteins to perform their diverse functions, including signal transduction, stress sensing, virulence, cell division, nutrient uptake, adhesion, and triggering host immune responses. The proper processing of lipoproteins by LspA is vital for bacterial survival, particularly in Gram-negative bacteria where this pathway is essential .

How is the lspA gene structured and conserved across bacterial species?

The lspA gene encodes the type II signal peptidase enzyme and shows significant conservation in key functional domains across bacterial species. Sequence analyses reveal five highly conserved domains (boxes A, B, C, D, and E) that are essential for enzymatic activity of bacterial SPase II. Box A contains an aspartic acid residue necessary for enzyme stability and function. Box B carries invariable asparagine and glycine residues. Box C contains asparagines and an aspartic acid that are critical for SPase II activity, with the aspartic acid proposed to be one of the catalytic residues at the active site. Box E features asparagine, alanine, and aspartic acid residues that play important roles in prelipoprotein processing .

While there is high sequence identity among lspA genes within related bacterial genera (ranging from 75% to 91% identity among rickettsial species), identity with more distant bacteria can be considerably lower (around 22% between Rickettsia and E. coli) . This pattern of conservation reflects evolutionary pressure to maintain critical catalytic and structural features while allowing species-specific adaptations.

Why is LspA considered a promising target for antibiotic development?

LspA represents an excellent target for the development of antibiotic therapeutics for several compelling reasons:

  • Essentiality: The enzyme is essential in Gram-negative bacteria, including important pathogens like Escherichia coli, Salmonella enterica, and Mycobacterium tuberculosis.

  • Virulence connection: It is important for virulence in Gram-positive bacteria.

  • Resistance barrier: The highly conserved active site suggests that resistance mutations would likely interfere with the enzyme's ability to bind and cleave its natural substrates.

  • Specificity: LspA has no mammalian homologs, potentially allowing for selective targeting with minimal host toxicity .

These characteristics collectively suggest that inhibitors of LspA could serve as effective antibiotics with a high barrier to resistance development, addressing a critical need in the era of increasing antibiotic resistance .

What expression patterns does lspA exhibit during bacterial growth and infection?

The transcription of lspA shows a differential expression pattern during various stages of bacterial intracellular growth. Studies in Rickettsia typhi reveal that lspA expression is higher at the preinfection stage, followed by a decrease until 8 hours post-infection. After the bacterial doubling time (beyond 8 hours), expression levels increase, peaking at 48 hours post-infection. As host cells begin to lyse (around 120 hours post-infection), expression decreases .

What are the optimal conditions for expressing and purifying recombinant S. arizonae LspA?

For the expression and purification of recombinant Salmonella arizonae LspA, researchers should consider the following optimized protocol based on established methods for similar membrane proteins:

  • Expression system: Use a pET28b vector with an N-terminal 6xHis tag and thrombin cleavage sequence in E. coli, similar to successful expression of P. aeruginosa LspA .

  • Culture conditions: Grow transformed E. coli at 37°C until an OD600 of 0.6-0.8, then induce with IPTG (0.5-1 mM) and continue expression at a reduced temperature (16-20°C) for 16-18 hours to enhance proper folding of the membrane protein.

  • Membrane fraction isolation: Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors. Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour).

  • Solubilization: Extract LspA from membranes using an appropriate detergent such as n-dodecyl-β-D-maltopyranoside (DDM) or Fos-choline-12 (FC12) at concentrations above their critical micelle concentration.

  • Purification: Perform immobilized metal affinity chromatography using Ni-NTA resin, followed by size exclusion chromatography to obtain homogeneous protein.

  • Protein quality assessment: Verify purity by SDS-PAGE and functional integrity by activity assays against synthetic peptide substrates or by globomycin binding studies .

This methodology should yield purified recombinant LspA suitable for structural and functional studies, including crystallization attempts or reconstitution into liposomes for enzymatic assays.

How can conformational dynamics of LspA be studied using molecular dynamics and spectroscopic techniques?

Studying the conformational dynamics of LspA requires a hybrid approach combining computational and experimental techniques:

Molecular Dynamics (MD) Simulations:

  • System preparation: Embed the LspA structure in a lipid bilayer mimicking bacterial membrane composition, solvate with explicit water molecules, and add counter ions to neutralize the system.

  • Simulation parameters: Run multiple independent simulations (>100 ns each) with different starting conditions to sample conformational space adequately.

  • Analysis techniques: Track the movement of the periplasmic helix and β-cradle, measure distances between key residues, and identify distinct conformational states using clustering algorithms and principal component analysis.

Electron Paramagnetic Resonance (EPR) Studies:

  • Site-directed spin labeling: Introduce cysteine residues at strategic positions (particularly in the periplasmic helix and β-cradle) and label with spin probes such as MTSL (1-oxyl-2,2,5,5-tetramethylpyrroline-3-methyl methanethiosulfonate).

  • Continuous-wave (CW) EPR: Perform at room temperature to assess mobility and environment of the spin labels, revealing nanosecond timescale dynamics of specific regions.

  • Double Electron-Electron Resonance (DEER): Measure distances between pairs of spin labels to validate conformational states identified in MD simulations.

In previous studies of P. aeruginosa LspA, this integrated approach revealed that the periplasmic helix fluctuates on the nanosecond timescale, sampling multiple conformations that correlate with function. The apo state predominantly adopts a closed conformation that occludes the charged active site from the lipid bilayer, while antibiotic binding shifts the equilibrium toward more open conformations .

The combination of these techniques provides complementary insights: MD simulations offer atomic-level detail and dynamics across multiple timescales, while EPR experiments validate the physiological relevance of the identified conformational states.

What are the key structural features of the LspA active site and how do they relate to function?

The active site of LspA exhibits several key structural features that are critical for its function as a type II signal peptidase:

  • Catalytic Dyad: The active site contains two aspartic acid residues that form a catalytic dyad essential for proteolytic activity. These residues are located in conserved domains C and E .

  • Conserved Residues: Surrounding the catalytic dyad are approximately 14 highly conserved residues that shape the active site pocket. This extensive conservation indicates that mutations in this region would likely impair both antibiotic binding and substrate processing .

  • Periplasmic Helix (PH): This flexible structural element plays a critical role in controlling access to the active site. The PH fluctuates between:

    • A closed conformation that occludes the charged active site from the lipid bilayer

    • An intermediate conformation often stabilized by antibiotic binding

    • An open conformation that creates a trigonal cavity where lipoprotein substrate can bind

  • β-cradle: This structural feature works in concert with the PH to "clamp" substrates in place. In the most closed conformation, the distance between the β-cradle and PH is approximately 6.2 Å, completely occluding the active site .

  • Hydrophobic/Hydrophilic Balance: The active site must accommodate the hydrophobic transmembrane helix of the signal peptide while maintaining catalytically active polar residues in an otherwise membrane environment.

The functional significance of these features is demonstrated by the enzyme's conformational cycle: in the apo state, the enzyme predominantly adopts the closed configuration that protects the polar active site from the hydrophobic membrane environment. Upon substrate approach, the PH can transition to the open state, allowing substrate binding. For catalysis, the enzyme likely adopts the intermediate conformation, positioning the signal peptide cleavage site precisely at the catalytic dyad .

How does antibiotic binding affect the conformational states of LspA?

Antibiotic binding significantly alters the conformational equilibrium of LspA, providing insights into both inhibition mechanisms and natural substrate interactions:

  • Shift in Conformational Equilibrium: MD simulations and EPR studies reveal that when globomycin (a cyclic peptide antibiotic) binds to LspA, the enzyme shifts from predominantly occupying the closed state to favoring an intermediate conformation. This is evidenced by changes in distance distributions between the periplasmic helix and β-cradle structures .

  • Multiple Binding Modes: Globomycin exhibits multiple binding modes while maintaining interactions with the catalytic dyad. This suggests that the antibiotic-bound state still retains conformational flexibility, though more restricted than the apo state .

  • Inhibition Mechanism: The antibiotic-stabilized intermediate conformation inhibits both signal peptide cleavage and substrate binding by occupying the active site and preventing the enzyme from adopting the fully open conformation required for substrate access .

  • Comparative Analysis: Different antibiotics (such as globomycin and myxovirescin) stabilize slightly different conformations of the PH while maintaining similar interactions with the catalytic residues. This indicates that the PH can adapt to accommodate different inhibitor structures .

  • Implications for Resistance: The flexible nature of the active site allows it to bind diverse substrates, but this same flexibility permits binding of structurally different antibiotics. This presents a challenge for bacteria to develop resistance mutations that would prevent antibiotic binding without compromising substrate processing .

These findings suggest that effective LspA inhibitors should stabilize non-functional conformations of the enzyme rather than simply occupying the active site, potentially providing a strategy for developing new antibiotics targeting this essential enzyme.

What methods can be used to assess LspA inhibition for antibiotic development?

Development of LspA inhibitors as potential antibiotics requires robust methods for assessing enzyme inhibition. The following methodological approaches are particularly valuable:

  • In vitro enzymatic assays:

    • Fluorogenic peptide substrates: Design synthetic peptides mimicking natural LspA cleavage sites conjugated to fluorophore/quencher pairs that produce measurable signals upon cleavage.

    • HPLC-based assays: Monitor cleavage of synthetic lipoprotein signal peptides using reverse-phase HPLC to quantify substrate consumption and product formation.

    • Reconstituted membrane systems: Incorporate purified LspA into liposomes with synthetic lipopeptide substrates to better mimic the native membrane environment.

  • Biophysical binding assays:

    • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters of inhibitor binding.

    • Surface plasmon resonance (SPR): Measure binding kinetics of inhibitors to immobilized LspA.

    • Differential scanning fluorimetry: Assess thermal stabilization of LspA upon inhibitor binding.

  • Structural studies:

    • X-ray crystallography of LspA-inhibitor complexes: Provides atomic-level details of binding modes.

    • EPR spectroscopy: Determine how inhibitors affect the conformational dynamics of LspA, particularly the orientation of the periplasmic helix .

    • Hydrogen-deuterium exchange mass spectrometry: Map regions of altered dynamics upon inhibitor binding.

  • Cellular assays:

    • Accumulation of unprocessed prolipoproteins: Monitor using Western blotting with antibodies against specific bacterial lipoproteins.

    • Bacterial growth inhibition: Determine minimal inhibitory concentrations (MICs) against wild-type and LspA-overexpressing strains.

    • Synergy testing: Evaluate combinations with other antibiotics targeting different pathways.

  • Resistance development assessment:

    • Serial passage experiments: Culture bacteria with sub-inhibitory concentrations of compounds to monitor development of resistance.

    • Whole genome sequencing of resistant mutants: Identify potential resistance mechanisms.

    • Site-directed mutagenesis of conserved residues: Test how specific mutations affect inhibitor binding versus substrate processing.

The combination of these approaches provides a comprehensive assessment of inhibitor efficacy, mechanism of action, and potential for resistance development, guiding structure-based optimization of lead compounds.

How can site-directed mutagenesis be used to study the catalytic mechanism of S. arizonae LspA?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of S. arizonae LspA. A comprehensive mutagenesis strategy should include:

  • Catalytic Residue Identification:

    • Target the conserved aspartic acids in boxes C and E that form the putative catalytic dyad. Mutations such as D→N or D→A would maintain similar sterics while eliminating the carboxyl group essential for catalysis.

    • Create conservative and non-conservative mutations (e.g., D→E vs. D→A) to distinguish between roles in catalysis versus structural integrity.

  • Substrate Binding Pocket Analysis:

    • Mutate conserved residues in the β-cradle and periplasmic helix that are predicted to interact with the substrate's signal peptide and lipid moiety.

    • Generate alanine scanning mutations across these regions to map the contribution of each residue to substrate recognition.

  • Conformational Dynamics Investigation:

    • Introduce mutations at the interface between the periplasmic helix and β-cradle to alter the equilibrium between open, intermediate, and closed conformations.

    • Create disulfide bonds between strategically placed cysteine residues to lock the enzyme in specific conformational states.

  • Experimental Assessment of Mutants:

    • Enzyme kinetics: Measure Km and kcat parameters using synthetic substrates to quantify effects on substrate binding and catalytic efficiency.

    • Thermal stability: Assess how mutations affect protein stability using differential scanning calorimetry or fluorimetry.

    • Structural analysis: Use EPR spectroscopy with spin-labeled mutants to determine how mutations affect conformational dynamics.

    • In vivo complementation: Test whether mutant LspA can restore growth in temperature-sensitive E. coli strains (similar to the approach used with R. typhi LspA) .

  • Comparative Analysis:

    • Create a table correlating mutation position, type of amino acid substitution, effect on enzyme activity, effect on substrate binding, and effect on conformational dynamics.

    • Map mutations onto structural models to visualize patterns and identify functionally distinct regions of the enzyme.

This systematic approach would provide detailed insights into how specific residues contribute to catalysis, substrate recognition, and the conformational changes required for LspA function. The results could guide the design of more effective inhibitors targeting specific aspects of the catalytic mechanism.

What challenges exist in expressing membrane proteins like LspA and how can they be overcome?

Membrane proteins like LspA present several significant challenges for recombinant expression and purification. Here are the primary difficulties and strategies to overcome them:

  • Toxicity to expression hosts:

    • Challenge: Overexpression of membrane proteins can disrupt host cell membrane integrity and function.

    • Solution: Use tightly regulated expression systems with low basal expression (such as pET vectors with T7lac promoters), consider host strains with enhanced membrane protein expression capacity (like C41/C43), or employ cell-free expression systems.

  • Protein misfolding and aggregation:

    • Challenge: The complex membrane environment is difficult to replicate in expression systems.

    • Solution: Lower expression temperature (16-20°C), add specific lipids to growth media, use fusion tags that enhance solubility (MBP, SUMO), or include chemical chaperones like glycerol in growth media.

  • Detergent selection for solubilization:

    • Challenge: Finding detergents that efficiently extract the protein while maintaining its native fold and activity.

    • Solution: Screen a panel of detergents (maltoside-based, Fos-cholines, etc.) at various concentrations, consider using detergent mixtures, or utilize styrene-maleic acid copolymers (SMALPs) that extract membrane proteins with their native lipid environment.

  • Protein stability post-extraction:

    • Challenge: Membrane proteins often destabilize when removed from the lipid bilayer.

    • Solution: Include specific lipids during purification, use lipid-detergent mixed micelles, or reconstitute into nanodiscs or liposomes as soon as possible after purification.

  • Low expression yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host, use strong promoters with inducible control, and scale up culture volumes to compensate for lower per-cell yields.

For LspA specifically, successful expression has been achieved using the pET28b vector with an N-terminal 6xHis tag in E. coli, followed by purification in FC12 detergent micelles . This system allows for both structural studies and functional assays, demonstrating that despite the challenges, properly folded and active LspA can be obtained through careful optimization of expression and purification conditions.

How does the expression level of lspA compare with other genes in the lipoprotein processing pathway?

Comparative transcriptional analysis of genes involved in the lipoprotein processing pathway reveals important insights into their relative expression and coordination:

Key observations from transcriptional studies:

  • Coordinated expression: The lspA and lgt genes, which are both specifically involved in lipoprotein processing, show similar expression patterns throughout the bacterial growth cycle. This coordination is logical given that Lgt acts immediately before LspA in the lipoprotein processing pathway .

  • Differential expression levels: The lepB gene, encoding type I signal peptidase which processes a broader range of secretory proteins (not just lipoproteins), consistently shows higher expression levels compared to lspA and lgt. This higher expression correlates with the greater substrate load for LepB, as in silico prediction indicates that out of 89 secretory proteins, only 14 are lipoproteins requiring LspA processing .

  • Growth phase dependence: All three genes show a characteristic expression pattern with higher levels during the preinfection stage, suggesting that metabolically active bacteria with fully functioning protein secretion systems are required for successful host cell invasion. After initial decrease post-infection, expression increases again after bacterial doubling time (8h), peaking at 48h post-infection .

  • Implications for pathway regulation: The similar expression patterns of lspA and lgt suggest co-regulation, potentially through shared regulatory elements or in response to the same cellular signals, while the distinct pattern of lepB indicates independent regulation mechanisms for the general secretory pathway versus the specialized lipoprotein processing pathway .

This transcriptional coordination ensures efficient processing of bacterial lipoproteins, which are critical for numerous cellular functions including virulence, stress response, and nutrient acquisition.

What techniques can be used to investigate LspA-substrate interactions?

Understanding the interactions between LspA and its lipoprotein substrates requires specialized techniques that can capture both binding events and subsequent catalytic steps. The following methodological approaches are particularly valuable:

  • Crosslinking-based approaches:

    • Photo-crosslinking: Incorporate photo-activatable amino acids into LspA or substrate peptides to capture transient interactions.

    • Chemical crosslinking followed by mass spectrometry (XL-MS): Identify residues in close proximity at the enzyme-substrate interface.

    • Disulfide trapping: Engineer cysteine residues at predicted interaction sites to form reversible crosslinks during binding.

  • Structural biology techniques:

    • X-ray crystallography: Attempt co-crystallization with substrate analogs or non-cleavable substrate mimics.

    • Cryo-EM: Visualize LspA-substrate complexes, potentially capturing different states of the catalytic cycle.

    • NMR spectroscopy: Map chemical shift perturbations upon substrate binding to identify interaction surfaces.

  • Biophysical binding assays:

    • Surface plasmon resonance (SPR): Measure binding kinetics and affinity using immobilized LspA and synthetic substrate analogs.

    • Microscale thermophoresis (MST): Detect substrate binding in solution with minimal protein consumption.

    • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters of binding.

  • Molecular dynamics simulations:

    • Docking studies: Predict binding modes of substrate peptides in the LspA active site.

    • Steered molecular dynamics: Simulate substrate entry into the active site through the open conformation.

    • Free energy calculations: Estimate binding affinities and identify key interaction residues.

  • Functional assays:

    • Substrate competition assays: Compare processing rates of different natural substrates to identify preference patterns.

    • Mutational analysis: Systematically alter substrate sequence to map recognition determinants.

    • Activity-based protein profiling: Use activity-based probes that bind to active LspA to compete with natural substrates.

The model of substrate binding derived from experimental data suggests that the β-cradle and periplasmic helix "clamp" the substrate in place, with the β-cradle and PH distance adjusting to accommodate different substrates. This flexible active site explains how LspA can process a variety of lipoprotein substrates despite their sequence differences . The combination of these techniques would provide comprehensive insights into the molecular basis of substrate recognition and processing by LspA.

How can recombinant LspA be used for high-throughput screening of novel antibiotics?

Recombinant LspA provides an excellent platform for high-throughput screening (HTS) of potential antibiotics. A comprehensive screening system would include the following components:

  • Enzymatic activity-based primary screening:

    • Design fluorogenic or chromogenic substrates based on natural LspA cleavage sites that produce measurable signals upon cleavage.

    • Implement in 384 or 1536-well microplate format with automated liquid handling.

    • Include positive controls (known inhibitors like globomycin) and negative controls.

    • Calculate Z' factor to ensure assay quality and reproducibility.

    • Screen compound libraries at single concentration (10-20 μM) with hit criteria of >50% inhibition.

  • Secondary confirmation assays:

    • Dose-response curves to determine IC50 values.

    • Counter-screening against other aspartyl proteases to assess selectivity.

    • Thermal shift assays to confirm direct binding to LspA.

    • Alternative substrate assays to rule out interference with detection system.

  • Tertiary cellular assays:

    • Bacterial growth inhibition assays comparing wild-type and LspA-overexpressing strains.

    • Western blot detection of unprocessed prolipoprotein accumulation in treated bacteria.

    • Cytotoxicity assessment against mammalian cells to establish preliminary safety profile.

  • Biophysical characterization of hits:

    • Surface plasmon resonance or isothermal titration calorimetry to determine binding constants.

    • X-ray crystallography or cryo-EM to determine binding modes of promising leads.

    • EPR spectroscopy to assess effects on conformational dynamics of the periplasmic helix .

  • Data analysis and compound prioritization:

    • Create a scoring matrix incorporating potency, selectivity, physicochemical properties, and structural novelty.

    • Cluster compounds by chemical scaffold to identify structure-activity relationships.

    • Prioritize compounds that stabilize non-functional conformations of LspA.

This approach leverages the understanding that LspA exists in an equilibrium of conformational states, with inhibitors like globomycin stabilizing specific conformations that prevent substrate binding and processing . Compounds that similarly disrupt this conformational equilibrium represent promising candidates for further development as antibiotics with a high barrier to resistance development.

What is the role of LspA in bacterial virulence and how can this be experimentally validated?

Lipoprotein signal peptidase (LspA) plays a significant role in bacterial virulence through its essential function in processing lipoproteins that mediate host-pathogen interactions. Here's how this role can be experimentally validated:

  • Generation of conditional knockdowns or temperature-sensitive mutants:

    • Since lspA is essential in many Gram-negative bacteria, complete knockouts may not be viable. Instead, use:

    • Inducible antisense RNA to deplete LspA expression

    • Temperature-sensitive LspA variants

    • CRISPR interference (CRISPRi) for inducible repression

    • Chemical genetic approaches with engineered inhibitor sensitivity

  • In vitro virulence assays:

    • Adhesion and invasion assays using epithelial cell lines

    • Survival within macrophages or neutrophils

    • Biofilm formation capacity

    • Resistance to serum killing or antimicrobial peptides

    • Secretion of virulence factors

  • Transcriptomic and proteomic analyses:

    • RNA-Seq to identify changes in virulence gene expression when LspA is depleted

    • Proteomics to quantify changes in lipoprotein processing and abundance

    • Membrane proteome analysis to detect accumulation of unprocessed prolipoproteins

    • Secretome analysis to identify altered secretion of virulence factors

  • In vivo infection models:

    • Competitive infection assays comparing wild-type and LspA-depleted strains

    • Measurement of bacterial burden in tissues

    • Histopathological examination of infected tissues

    • Survival studies in appropriate animal models

    • Immune response characterization (cytokine profiles, cell recruitment)

  • Complementation studies:

    • Restore wild-type LspA expression to confirm phenotype reversion

    • Express catalytically inactive LspA mutants to distinguish enzymatic from structural roles

    • Cross-species complementation to assess functional conservation

Previous research has established that LspA is critical for intracellular growth and virulence in many bacteria . The higher transcriptional level of lspA and other lipoprotein processing genes at the preinfection time point indicates that metabolically active bacteria with fully functioning lipoprotein processing are required for successful infection and host cell interaction . Experimental validation of its role in Salmonella arizonae virulence would provide valuable insights into pathogenesis mechanisms and further support LspA as a therapeutic target.

What are the latest advances in understanding the catalytic mechanism of LspA?

Recent research has significantly advanced our understanding of the catalytic mechanism of LspA, revealing a sophisticated interplay between structure, dynamics, and function:

  • Conformational dynamics and catalysis:

    • Advanced molecular dynamics simulations coupled with EPR spectroscopy have revealed that LspA exists in an equilibrium between at least three conformational states: closed, intermediate, and open .

    • The periplasmic helix (PH) fluctuates on the nanosecond timescale, regulating access to the active site .

    • In the apo state, the dominant conformation is closed, occluding the charged active site from the hydrophobic membrane environment .

    • The open conformation creates a trigonal cavity that can accommodate the lipoprotein substrate .

  • Active site architecture:

    • The catalytic dyad consists of two aspartic acid residues located in conserved domains .

    • These residues are surrounded by approximately 14 highly conserved residues that shape the active site pocket .

    • The extensive conservation of these residues suggests that mutations affecting antibiotic binding would also likely interfere with substrate processing, creating a high barrier to resistance development .

  • Substrate binding mechanism:

    • The β-cradle and periplasmic helix function as a "clamp" that secures the substrate in the proper orientation for catalysis .

    • The flexibility of this clamp explains how LspA can accommodate and process a variety of substrates despite sequence differences .

    • The distance between the β-cradle and PH in the intermediate conformation (observed in antibiotic-bound states) may represent the optimal geometry for positioning the scissile bond at the catalytic dyad .

  • Inhibition insights:

    • Antibiotics like globomycin stabilize an intermediate conformation that prevents both substrate binding and catalysis .

    • Multiple binding modes are possible while maintaining interactions with the catalytic residues, suggesting flexibility in inhibitor design .

  • Membrane integration:

    • The enzyme must balance the need to shield polar catalytic residues from the hydrophobic membrane environment while allowing substrate access .

    • The closed conformation in the apo state likely serves to protect the charged active site when no substrate is present .

These advances provide a more complete picture of how LspA functions within the membrane environment and how its dynamic behavior enables both substrate recognition and catalysis. This mechanistic understanding is crucial for the rational design of inhibitors targeting specific aspects of the catalytic cycle.

What are common pitfalls in LspA activity assays and how can they be addressed?

Researchers working with LspA activity assays face several technical challenges that can affect reliability and reproducibility. Here are the most common pitfalls and strategies to overcome them:

  • Detergent interference with enzyme activity:

    • Pitfall: Detergents used to solubilize LspA can alter its activity or interfere with substrate binding.

    • Solution: Screen multiple detergents at minimal effective concentrations; consider native nanodiscs or liposome reconstitution; maintain consistent detergent concentration across all assay components.

  • Substrate design limitations:

    • Pitfall: Synthetic substrates may not fully recapitulate the complexity of natural lipoprotein substrates.

    • Solution: Design substrates that include both the lipid moiety and signal peptide; validate with natural lipoprotein substrates; consider pre-loading substrates into liposomes before adding LspA.

  • Preservation of conformational dynamics:

    • Pitfall: In vitro conditions may not support the full range of conformational states observed in vivo.

    • Solution: Include appropriate lipids in the assay buffer; perform assays at physiologically relevant temperatures; validate key findings with complementary methods like EPR spectroscopy .

  • Assay readout challenges:

    • Pitfall: Direct monitoring of proteolytic activity can be difficult in membrane environments.

    • Solution: Use FRET-based peptide substrates designed to minimize background; employ HPLC separation of cleaved products; develop antibodies specific to processed/unprocessed forms.

  • Reproducibility concerns:

    • Pitfall: Batch-to-batch variation in enzyme preparation or substrate quality.

    • Solution: Establish stringent quality control criteria; include internal standards; normalize results to positive controls; perform multiple independent experiments.

  • Non-specific inhibition:

    • Pitfall: Compounds that appear to inhibit LspA may actually be aggregators or membrane disruptors.

    • Solution: Include detergent controls; test for activity against unrelated enzymes; perform dose-response curves; validate through direct binding assays.

  • Expression and purification challenges:

    • Pitfall: Low yields or partially denatured enzyme affecting activity measurements.

    • Solution: Optimize expression conditions; verify proper folding through activity against known substrates; include tags that enhance solubility without compromising function.

By addressing these common pitfalls, researchers can develop more robust and reliable assays for LspA activity, facilitating both mechanistic studies and drug discovery efforts targeting this essential bacterial enzyme.

How can researchers differentiate between direct LspA inhibition and secondary effects in whole-cell assays?

When evaluating potential LspA inhibitors in whole-cell assays, distinguishing direct inhibition from indirect effects is crucial. Here are methodological approaches to make this differentiation:

  • Target overexpression studies:

    • Approach: Compare sensitivity of wild-type bacteria versus strains overexpressing LspA.

    • Interpretation: Direct inhibitors will show reduced efficacy against overexpressing strains (higher MIC values) due to increased target concentration.

    • Control: Include a known LspA inhibitor (globomycin) and inhibitors of unrelated pathways.

  • Accumulation of unprocessed lipoproteins:

    • Approach: Use Western blotting with antibodies against specific bacterial lipoproteins to detect prolipoprotein forms.

    • Interpretation: Direct LspA inhibition causes accumulation of specific prolipoproteins, while indirect effects typically do not show this pattern.

    • Quantification: Compare the ratio of processed/unprocessed forms across multiple lipoprotein substrates.

  • Genetic complementation with resistant variants:

    • Approach: Express LspA variants with mutations at inhibitor binding sites but retained catalytic function.

    • Interpretation: Complementation restores growth in the presence of direct inhibitors but not with compounds acting through other mechanisms.

    • Validation: Confirm that the mutant LspA remains functional using in vitro activity assays.

  • Binding assays with purified protein:

    • Approach: Use surface plasmon resonance, thermal shift assays, or isothermal titration calorimetry.

    • Interpretation: Direct inhibitors show concentration-dependent binding to purified LspA.

    • Control: Include inactive analogs of test compounds to confirm specificity.

  • Time-course analysis of cellular effects:

    • Approach: Monitor changes in cell physiology, membrane integrity, and lipoprotein processing over time.

    • Interpretation: Direct LspA inhibition typically shows accumulation of unprocessed lipoproteins before other cellular effects become apparent.

    • Correlation: Establish temporal relationship between biochemical changes and loss of viability.

  • Comparison with known inhibitor profiles:

    • Approach: Compare phenotypic effects with those of globomycin, a known specific LspA inhibitor.

    • Interpretation: Similar patterns suggest direct LspA inhibition; divergent patterns indicate different mechanisms.

    • Analysis: Create a similarity matrix of cellular effects across multiple parameters.

  • Structural studies:

    • Approach: Obtain crystal structures or use computational docking of compounds with purified LspA.

    • Interpretation: Direct inhibitors will show specific interactions with the active site or allosteric sites.

    • Validation: Correlate structural data with functional assays and mutagenesis studies.

By employing these complementary approaches, researchers can confidently distinguish compounds that directly inhibit LspA from those that affect bacterial viability through other mechanisms, enabling more focused optimization of genuine LspA inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.