Recombinant Salmonella arizonae p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Salmonella arizonae p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA) is a protein component of an efflux pump found in Salmonella arizonae . Efflux pumps are crucial in bacterial resistance mechanisms, as they actively transport various compounds, including antibiotics and toxins, out of the cell . The AaeA subunit, specifically, is part of a system that responds to the presence of p-hydroxybenzoic acid (pHBA) and other aromatic carboxylic acids .

Function: AaeA forms an efflux pump with AaeB and belongs to the membrane fusion protein (MFP) family .

Discovery and Characterization

The AaeA protein was identified and characterized during research on efflux pumps in Escherichia coli. Initially, the gene yhcP was found to be upregulated in E. coli when exposed to p-hydroxybenzoic acid (pHBA) . Further investigation revealed that yhcP encodes a protein belonging to a putative efflux protein family. Adjacent genes, yhcQ (encoding a membrane fusion protein) and yhcR (encoding a small protein), were also upregulated . The upstream gene yhcS, encoding a LysR family regulatory protein, was shown to regulate the expression of yhcRQP .

It was demonstrated that several aromatic carboxylic acids induce yhcRQP expression, and a yhcP mutant strain displayed hypersensitivity to pHBA, confirming its efflux function. Consequently, yhcS, yhcR, yhcQ, and yhcP were renamed aaeR, aaeX, aaeA, and aaeB, respectively, to reflect their role in aromatic carboxylic acid efflux .

Role in Efflux

AaeA, along with AaeB, functions as an efflux pump responsible for exporting aromatic carboxylic acids like pHBA out of the bacterial cell . This mechanism helps the bacteria to tolerate and resist the toxic effects of these compounds . Efflux pumps like AaeAB contribute to multidrug resistance by expelling various antimicrobials, thereby reducing their intracellular concentration .

Regulation

The expression of the aaeA gene, along with aaeB and other related genes, is regulated by AaeR, a LysR family regulatory protein . The system is induced by the presence of aromatic carboxylic acids, suggesting a role as a "metabolic relief valve" to mitigate the harmful effects of imbalanced metabolism .

The regulation of efflux pumps can also be influenced by other factors. For instance, the multidrug efflux pump AcrAB in Salmonella is regulated by RamA in response to environmental signals such as bile . Indole, produced by E. coli, can induce the expression of acrAB via the RamA regulator .

Efflux Pumps and Virulence

Efflux pumps are not only involved in antibiotic resistance but also play a role in bacterial virulence . For example, the AcrAB-TolC system in E. coli is involved in multidrug resistance and the regulation of virulence . Similarly, the SugE efflux pump in Salmonella 4,,12:i:- influences resistance to disinfectants and affects virulence by modulating the expression of genes involved in adhesion and invasion .

Relevance to Salmonella arizonae

In Salmonella arizonae, AaeA contributes to the bacterium's ability to withstand environmental stresses, including exposure to aromatic compounds . By effectively pumping out these compounds, Salmonella arizonae maintains cellular homeostasis and protects itself from toxic substances .

Table Summarizing Key Features of AaeA

FeatureDescription
Namep-hydroxybenzoic acid efflux pump subunit AaeA
FunctionPart of an efflux pump system
SubunitsForms a pump with AaeB
FamilyMembrane Fusion Protein (MFP)
OrganismSalmonella arizonae
SubstratesAromatic carboxylic acids, including p-hydroxybenzoic acid (pHBA)
RegulationRegulated by AaeR (LysR family protein); induced by aromatic carboxylic acids
RoleContributes to resistance against toxic compounds; maintains cellular homeostasis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SARI_04268; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVQKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNTSSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does AaeA expression relate to antimicrobial resistance mechanisms?

AaeA expression can significantly contribute to antimicrobial resistance in Salmonella through active efflux mechanisms. Like other efflux pumps in Salmonella species, AaeA likely participates in the extrusion of antibiotics and toxic compounds, reducing their intracellular concentration and effectiveness .

Research on similar efflux systems in Salmonella demonstrates that these pumps can contribute to resistance against multiple classes of antibiotics. For example, the OqxAB efflux pump in Salmonella contributes to reduced susceptibility to olaquindox, nalidixic acid, tigecycline, nitrofurantoin, and chloramphenicol . While AaeA is specific for p-hydroxybenzoic acid, its activity may overlap with other compounds of similar structure.

The multifaceted relationship between efflux pump expression and antimicrobial resistance can be summarized in this comparison table:

MechanismAaeA-Type EffluxOther Known Efflux Systems (e.g., OqxAB)
Substrate specificityp-hydroxybenzoic acid and similar aromatic compoundsBroader spectrum including quinolones, tetracyclines, and phenicols
Genetic locationChromosomalBoth chromosomal and plasmid-borne
RegulationEnvironmental stress responseOften co-regulated with other resistance determinants
Contribution to MDRModerateSignificant, especially when overexpressed
Evolutionary originConserved across Salmonella speciesMay be acquired through horizontal gene transfer

What methodologies are used to purify recombinant AaeA?

Purification of recombinant AaeA typically follows established protocols for membrane proteins with modifications specific to this protein's characteristics:

  • Expression system selection: E. coli BL21(DE3) or similar strains are commonly used for heterologous expression of recombinant Salmonella proteins.

  • Vector design: The aaeA gene can be cloned into expression vectors with appropriate tags (His-tag, GST, etc.) to facilitate purification.

  • Induction conditions: Optimized IPTG concentration (typically 0.5-1.0 mM) and induction temperature (often lowered to 18-25°C) to maximize protein yield and solubility.

  • Membrane fraction isolation: After cell lysis, differential centrifugation separates membrane fractions containing the target protein.

  • Detergent solubilization: Membrane proteins like AaeA require detergents (e.g., DDM, LDAO, or Triton X-100) for extraction from membranes.

  • Affinity chromatography: Utilizing the fusion tag for initial purification.

  • Size exclusion chromatography: For further purification and to assess protein oligomerization state.

  • Buffer optimization: Final storage buffer typically contains 50 mM Tris, pH 7.5-8.0, with glycerol (20-50%) for stability .

The purified protein should be stored at -20°C or -80°C to maintain stability, with repeated freeze-thaw cycles avoided to prevent denaturation .

How can researchers effectively study AaeA function in experimental systems?

To effectively study AaeA function, researchers should consider a multi-faceted approach combining genetic, biochemical, and biophysical techniques:

  • Gene knockout and complementation studies:

    • Generate ΔaaeA deletion mutants in Salmonella arizonae

    • Perform phenotypic characterization under different stress conditions

    • Complement with wild-type and mutant versions of the gene

  • Substrate transport assays:

    • Use radiolabeled or fluorescently labeled p-hydroxybenzoic acid

    • Implement inside-out membrane vesicles for direct transport measurements

    • Develop whole-cell accumulation/efflux assays with real-time monitoring

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays to identify interaction partners

    • Co-immunoprecipitation with epitope-tagged AaeA

    • Cross-linking studies followed by mass spectrometry

  • Structural biology approaches:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for structure determination

    • Molecular dynamics simulations based on homology models

  • Expression and regulation analysis:

    • qRT-PCR for gene expression under different conditions

    • Reporter gene fusions (e.g., aaeA-lacZ) to monitor promoter activity

    • ChIP-seq to identify transcription factors regulating aaeA expression

A critical methodology consideration is validating findings across multiple experimental systems, as efflux pump function can be influenced by membrane composition, cellular energetics, and environmental conditions.

What role might AaeA play in bacterial stress responses and virulence?

The role of AaeA in bacterial stress responses likely extends beyond its primary function in p-hydroxybenzoic acid efflux. Research on other Salmonella efflux systems suggests that AaeA may contribute to:

  • Osmotic stress tolerance: Efflux pumps can participate in ion homeostasis during osmotic shock.

  • Oxidative stress defense: By exporting toxic metabolites generated during oxidative stress.

  • Desiccation resistance: Similar to how other membrane proteins contribute to Salmonella's remarkable desiccation tolerance .

  • Biofilm formation: Efflux pumps often play roles in quorum sensing molecule transport and biofilm development.

  • Host colonization: By providing resistance to host-derived antimicrobial compounds.

Studies on the transcriptional response of Salmonella to stress conditions reveal that various transport systems are differentially regulated during adaptation . For example, during dehydration stress, Salmonella upregulates several genes involved in transport functions, though AaeA specifically was not identified in the particular study cited .

The potential contribution of AaeA to virulence could be investigated by:

  • Infection models using wild-type and ΔaaeA mutant strains

  • Transcriptomic analysis of aaeA expression during host cell infection

  • Assessment of bacterial survival in the presence of host antimicrobial peptides

How do prophage elements influence the expression and function of efflux pumps like AaeA?

Prophage elements can significantly impact the expression and function of bacterial genes, including those encoding efflux pumps like AaeA. This relationship is complex and multifaceted:

  • Transcriptional regulation: Prophage-encoded transcription factors may directly or indirectly regulate efflux pump expression. Studies have shown that diverse prophage elements are encoded in Salmonella genomes and can influence the expression of bacterial genes .

  • Genetic context modification: Prophage integration can alter the genetic context of neighboring genes, potentially affecting their expression through changes in local DNA topology or disruption of regulatory elements.

  • Horizontal gene transfer: Prophages facilitate the transfer of genetic material between bacteria, potentially spreading novel efflux pump variants or regulatory elements . The cloud relationships formed between Salmonella, their prophages, and phages of other related enteric bacteria demonstrate the potential for genetic exchange .

  • Co-evolution of resistance mechanisms: Prophages carrying virulence factors may co-select for enhanced efflux pump activity to ensure bacterial survival under antimicrobial pressure.

Research on fifteen prevalent Salmonella enterica serovars has demonstrated that prophages encode various virulence factors linked to secretion systems, adherence, nutrition, stress response, and resistance to antimicrobial compounds . While this specific study did not mention AaeA directly, it establishes the principle that prophage elements contribute significantly to Salmonella's pathogenicity and resistance profiles.

To investigate this relationship specifically for AaeA, researchers could:

  • Compare aaeA expression in lysogenic vs. non-lysogenic strains

  • Identify potential prophage-encoded regulators that interact with the aaeA promoter

  • Analyze the genomic context of aaeA across different Salmonella strains to detect nearby prophage elements

What analytical techniques best characterize AaeA-substrate interactions?

Characterizing AaeA-substrate interactions requires specialized analytical techniques that can provide insights into binding affinities, transport kinetics, and structural changes. The most effective approaches include:

  • Surface Plasmon Resonance (SPR):

    • Allows real-time monitoring of protein-substrate interactions

    • Can determine association and dissociation rate constants

    • Requires careful membrane protein reconstitution on sensor chips

  • Isothermal Titration Calorimetry (ITC):

    • Measures thermodynamic parameters of binding (ΔH, ΔS, ΔG)

    • Works with detergent-solubilized membrane proteins

    • Provides stoichiometry information

  • Fluorescence-based assays:

    • FRET (Förster Resonance Energy Transfer) for conformational changes during substrate binding

    • Intrinsic tryptophan fluorescence quenching upon substrate interaction

    • Environment-sensitive fluorescent probes incorporated into the protein or substrate

  • Cryo-EM and molecular dynamics:

    • Structural snapshots of the protein with and without bound substrate

    • Computational modeling of substrate docking and transport pathway

  • Transport assays with substrate analogs:

    • Structure-activity relationship studies with modified p-hydroxybenzoic acid derivatives

    • Competition assays to determine substrate specificity profiles

    • pH-dependent transport studies to elucidate the energetics of the transport mechanism

Researchers should consider combining multiple techniques to build a comprehensive understanding of AaeA-substrate interactions, as each method has specific strengths and limitations when applied to membrane transport proteins.

How can AaeA be targeted for antimicrobial development?

Targeting efflux pumps like AaeA represents a promising strategy for antimicrobial development, potentially enhancing the efficacy of existing antibiotics or serving as standalone antimicrobial targets. Several approaches warrant investigation:

  • Direct inhibition strategies:

    • Competitive inhibitors that bind to the substrate-binding pocket

    • Allosteric inhibitors that prevent conformational changes necessary for transport

    • Covalent modifiers targeting essential residues in the transport channel

  • Expression modulation approaches:

    • Antisense oligonucleotides targeting aaeA mRNA

    • CRISPR-Cas9-based gene repression

    • Small molecules that interfere with regulatory pathways controlling aaeA expression

  • Energy disruption tactics:

    • Compounds that uncouple the energy source required for active transport

    • Proton gradient disruptors that specifically target efflux pump function

  • Structure-based drug design opportunities:

    • Homology modeling based on related efflux pump structures

    • Molecular docking to identify high-affinity binding compounds

    • Fragment-based drug discovery focusing on the substrate binding pocket

  • Combination therapy approaches:

    • Co-administration of efflux pump inhibitors with conventional antibiotics

    • Dual-action molecules with both pump inhibitory and antibiotic activities

The table below compares the advantages and challenges of different targeting strategies:

Targeting StrategyAdvantagesChallengesDevelopment Stage
Direct inhibitionSpecific effect, potentially low off-target impactRequires detailed structural knowledgeEarly research
Expression modulationMay affect multiple resistance mechanismsDelivery of nucleic acid-based therapeuticsPreclinical
Energy disruptionPotentially broad spectrum against multiple pumpsSelectivity concerns, potential toxicityConceptual
Structure-based designRational approach, potentially high affinityLimited structural data for AaeA specificallyDependent on structural elucidation
Combination therapyEnhanced efficacy of existing antibioticsDrug-drug interactions, complex development pathMost advanced

What are the optimal conditions for expressing recombinant AaeA in bacterial systems?

Optimizing expression conditions for recombinant AaeA requires careful consideration of multiple parameters to maximize protein yield while maintaining proper folding and functionality:

  • Expression host selection:

    • E. coli BL21(DE3) is commonly used for high-level expression

    • E. coli C41(DE3) or C43(DE3) strains are preferred for membrane proteins

    • Consider Salmonella-based expression systems for native post-translational modifications

  • Vector design considerations:

    • Promoter strength: T7 for high expression, araBAD for titratable expression

    • Codon optimization for the expression host

    • Fusion tags: N-terminal vs. C-terminal placement can affect folding

    • Signal sequences to direct membrane insertion

  • Induction parameters:

    • Temperature: Lower temperatures (16-25°C) often improve folding

    • Inducer concentration: Typically 0.1-0.5 mM IPTG for T7 systems

    • Induction timing: Mid-log phase (OD600 of 0.6-0.8) is standard

    • Duration: Extended expression periods (16-24 hours) at lower temperatures

  • Media composition:

    • Rich media (LB, TB, 2YT) for maximum biomass

    • Defined media for specific labeling (e.g., for NMR studies)

    • Supplements: 5-10% glycerol can enhance membrane protein expression

  • Post-induction handling:

    • Gentle cell harvesting to preserve membrane integrity

    • Buffer composition for cell lysis (typically containing protease inhibitors)

    • Detergent selection for protein extraction from membranes

Experimental optimization should follow a systematic approach, testing each parameter individually while monitoring expression levels through Western blotting and activity assays. For membrane proteins like AaeA, monitoring both total expression and proper membrane insertion is critical.

How can researchers effectively study AaeA interactions with other cellular components?

Studying AaeA interactions with other cellular components requires specialized techniques that accommodate its membrane-embedded nature:

  • Co-immunoprecipitation approaches:

    • Epitope-tagged AaeA (His, FLAG, or HA tags)

    • Crosslinking prior to solubilization to capture transient interactions

    • Mass spectrometry identification of co-precipitated proteins

  • Bacterial two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system optimized for membrane proteins

    • Split-ubiquitin systems adapted for bacterial membrane protein interactions

    • Systematic screening against genomic libraries to identify interaction partners

  • Protein-protein interaction visualization:

    • Fluorescence microscopy with fluorescently tagged proteins

    • Förster resonance energy transfer (FRET) between AaeA and potential partners

    • Bimolecular fluorescence complementation (BiFC) for in vivo interaction validation

  • Functional interaction studies:

    • Genetic synergy/epistasis analysis with potential partner genes

    • Suppressor screens to identify genes that can compensate for aaeA mutations

    • Biochemical reconstitution of multiprotein complexes in proteoliposomes

  • Systems biology approaches:

    • Correlation analysis of gene expression data to identify co-regulated genes

    • Network analysis to place AaeA in the context of cellular systems

    • Metabolomic profiling to identify metabolites affected by AaeA function

The integration of multiple approaches provides the most comprehensive understanding of AaeA's interaction network, crucial for deciphering its full role in bacterial physiology and pathogenesis.

What mutagenesis approaches can reveal functional domains in AaeA?

Systematic mutagenesis approaches provide critical insights into the structure-function relationships of AaeA:

  • Alanine-scanning mutagenesis:

    • Sequential replacement of amino acids with alanine

    • Identifies residues critical for substrate binding, transport, or structural integrity

    • Typically focused on predicted transmembrane regions or conserved motifs

  • Site-directed mutagenesis of conserved residues:

    • Targets amino acids conserved across homologous proteins

    • Tests specific hypotheses about catalytic or structural roles

    • Often guided by sequence alignments with better-characterized efflux pumps

  • Domain swapping experiments:

    • Exchange domains between AaeA and related efflux pump proteins

    • Identifies regions responsible for substrate specificity

    • Creates chimeric proteins with novel functional properties

  • Cysteine accessibility studies:

    • Introduction of cysteine residues at specific positions

    • Treatment with sulfhydryl-reactive compounds to probe accessibility

    • Maps transmembrane topology and substrate translocation pathway

  • Random mutagenesis approaches:

    • Error-prone PCR followed by functional screening

    • Identifies unexpected residues important for function

    • Can discover variants with enhanced activity or altered specificity

Each mutation should be evaluated using:

  • Expression level and membrane localization assessment

  • Transport activity assays with p-hydroxybenzoic acid

  • Substrate specificity profiling

  • Resistance phenotypes against relevant antimicrobials

The amino acid sequence analysis of AaeA indicates several regions of interest for targeted mutagenesis, including predicted transmembrane segments and potential substrate interaction sites.

How does environmental stress influence AaeA expression and function?

Environmental stressors significantly impact the expression and function of bacterial efflux systems, including potential effects on AaeA:

  • Transcriptional response to stressors:

    • Oxidative stress: Many efflux systems are upregulated under oxidative conditions

    • Acid stress: pH changes can trigger stress response pathways affecting efflux expression

    • Nutrient limitation: Starvation conditions alter global gene expression patterns

    • Desiccation: Salmonella shows specific transcriptional responses to dehydration, including changes in membrane protein expression

  • Post-transcriptional regulation:

    • Small RNAs may regulate efflux pump expression under stress conditions

    • RNA stability can be affected by environmental conditions

    • Translational efficiency might change under different stresses

  • Functional modifications:

    • Membrane fluidity changes under temperature stress affect efflux pump activity

    • Proton motive force alterations under energy stress impact transport efficiency

    • Protein stability and turnover rates may vary with environmental conditions

  • Experimental approaches to study stress effects:

    • Transcriptomics: RNA-seq or microarray analysis under defined stress conditions

    • Proteomics: Quantitative analysis of protein levels and modifications

    • Reporter gene fusions: Monitor aaeA promoter activity in real-time

    • Transport assays: Measure functional activity under stress conditions

Studies on Salmonella responses to dehydration have identified numerous genes with altered expression . While AaeA was not specifically mentioned in this study, the research approach demonstrates how similar analyses could be applied to investigate AaeA regulation under various stressors.

What bioinformatic approaches best predict AaeA structure and substrate specificity?

Advanced bioinformatic approaches provide valuable insights into AaeA structure and function:

  • Homology modeling approaches:

    • Template identification using HHpred or similar threading methods

    • Model building with MODELLER, SWISS-MODEL, or AlphaFold2

    • Model validation using PROCHECK, VERIFY3D, and molecular dynamics simulations

    • Special consideration for membrane protein-specific validation metrics

  • Sequence-based predictions:

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Conserved domain identification (InterPro, CDD)

    • Evolutionary analysis to identify functionally important residues (ConSurf)

    • Coevolution analysis to predict residue contacts (EVfold, GREMLIN)

  • Substrate specificity prediction:

    • Machine learning approaches trained on known efflux pump substrates

    • Molecular docking simulations of potential substrates

    • Pharmacophore modeling based on known substrates

    • Quantitative structure-activity relationship (QSAR) analysis

  • Functional network analysis:

    • Protein-protein interaction prediction

    • Gene neighborhood analysis across bacterial genomes

    • Co-expression network construction from transcriptomic data

    • Pathway enrichment to place AaeA in functional context

  • Comparative genomics approaches:

    • Analysis of selection pressure on aaeA across bacterial species

    • Identification of genetic variants in clinical isolates

    • Correlation of sequence variations with antimicrobial resistance profiles

These computational approaches can guide experimental design by generating testable hypotheses about structure-function relationships in AaeA, potentially accelerating the discovery of inhibitors or the engineering of variants with desired properties.

How can AaeA research contribute to understanding antimicrobial resistance mechanisms?

Research on AaeA provides valuable insights into antimicrobial resistance (AMR) mechanisms in several key areas:

  • Efflux-mediated resistance mechanisms:

    • Elucidating the structural basis of substrate recognition

    • Understanding the energetics of active efflux

    • Characterizing the regulation of efflux pump expression

    • Identifying how efflux systems respond to antibiotic exposure

  • Integration with other resistance mechanisms:

    • Interactions between efflux pumps and other resistance determinants

    • Coordinated regulation of multiple defense systems

    • Synergistic effects between efflux and target modifications

    • Role in facilitating the acquisition of additional resistance mechanisms

  • Evolution of resistance:

    • Selective pressures driving efflux pump diversification

    • Horizontal gene transfer of efflux determinants

    • Adaptive mutations affecting substrate specificity or expression

    • Contribution of mobile genetic elements to efflux pump dissemination

  • Clinical relevance:

    • Correlation between efflux pump expression and treatment outcomes

    • Potential as diagnostic markers for resistance

    • Targets for resistance-modifying adjuvants

    • Role in persistence and biofilm formation

Studies have demonstrated that efflux pumps like OqxAB contribute significantly to multidrug resistance in Salmonella, reducing susceptibility to multiple antibiotic classes . Similar mechanisms may apply to AaeA, particularly if its substrate range extends beyond p-hydroxybenzoic acid to include clinically relevant antimicrobials.

What are the challenges in developing inhibitors specific to AaeA?

Developing inhibitors specific to AaeA presents several significant challenges:

  • Structural complexity:

    • Limited structural information on AaeA specifically

    • Challenges in crystallizing membrane proteins

    • Dynamic nature of transport proteins with multiple conformational states

    • Difficulty in distinguishing between functional and non-functional conformations

  • Selectivity issues:

    • Distinguishing AaeA from host transporters to minimize toxicity

    • Differentiating between AaeA and other bacterial efflux pumps

    • Achieving serovar-specific targeting if desired

    • Avoiding disruption of essential physiological functions

  • Pharmacokinetic challenges:

    • Designing molecules that can penetrate the Gram-negative outer membrane

    • Achieving sufficient bioavailability and distribution

    • Preventing rapid metabolism or excretion

    • Maintaining stability in different physiological environments

  • Resistance development:

    • Potential for target mutations affecting inhibitor binding

    • Upregulation of alternative efflux systems

    • Selection pressure for compensatory mechanisms

    • Cross-resistance with other antimicrobials

  • Technical barriers in screening:

    • Establishing relevant high-throughput assays for membrane transporters

    • Distinguishing specific inhibition from membrane disruption

    • Translating in vitro activity to in vivo efficacy

    • Validating hits against clinically relevant isolates

These challenges necessitate a multidisciplinary approach combining structural biology, medicinal chemistry, microbiology, and pharmacology to develop effective and specific AaeA inhibitors.

How does AaeA compare with efflux pumps from other bacterial species?

Comparing AaeA with efflux pumps from other bacterial species reveals important evolutionary relationships and functional similarities:

  • Structural comparisons:

    • AaeA belongs to the p-hydroxybenzoic acid efflux pump family

    • Shares structural features with other RND family transporters

    • Contains characteristic transmembrane domains typical of efflux proteins

    • May have unique structural elements specific to Salmonella arizonae

  • Substrate specificity:

    • Primary substrate is p-hydroxybenzoic acid, an aromatic compound

    • More specialized compared to broad-spectrum pumps like AcrAB-TolC

    • May have evolved to address specific environmental challenges

    • Functional overlap with similar pumps in other enteric bacteria

  • Genetic context and regulation:

    • Gene organization may differ between species

    • Regulatory mechanisms might be species-specific

    • Evolutionary selection pressures vary by ecological niche

    • Mobile genetic elements contribute to dissemination patterns

  • Phylogenetic relationships:

    • Distribution across Salmonella serovars

    • Presence in related Enterobacteriaceae

    • Evolutionary history and selective pressures

    • Horizontal transfer versus vertical inheritance

  • Functional significance:

    • Role in pathogenesis may vary between species

    • Contribution to antibiotic resistance profiles differs

    • Importance in environmental persistence

    • Potential as species-specific therapeutic targets

The study of diverse prophage elements in Salmonella enterica serovars demonstrates how horizontal gene transfer contributes to the evolution and diversification of bacterial genomes . Similar mechanisms likely influenced the evolution of efflux systems like AaeA across bacterial species.

What techniques are most effective for studying AaeA in vivo dynamics?

Studying AaeA dynamics in vivo requires specialized techniques that can monitor protein activity and localization in living bacterial cells:

  • Fluorescent protein fusions:

    • AaeA-GFP or AaeA-mCherry fusions to visualize localization

    • Care must be taken to ensure fusion does not disrupt function

    • Photoactivatable or photoswitchable fluorescent proteins for pulse-chase studies

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

  • Live-cell substrate tracking:

    • Fluorescently labeled p-hydroxybenzoic acid derivatives

    • Real-time monitoring of substrate accumulation/efflux

    • Microfluidic systems for controlled exposure to substrates or inhibitors

    • Single-cell analysis to capture population heterogeneity

  • Gene expression dynamics:

    • Promoter-reporter fusions (aaeA promoter driving GFP expression)

    • Time-lapse microscopy to monitor expression changes

    • Flow cytometry for population-level analysis

    • Dual-reporter systems to correlate AaeA expression with cellular states

  • Protein-protein interactions in vivo:

    • FRET between tagged AaeA and interaction partners

    • Split-GFP complementation assays

    • Proximity labeling techniques (BioID, APEX)

    • Crosslinking followed by immunoprecipitation and MS analysis

  • Physiological response monitoring:

    • Membrane potential sensors to assess energetics

    • pH-sensitive fluorescent proteins to monitor proton gradients

    • Viability assays under various stress conditions

    • Correlating AaeA activity with cellular physiology

These approaches can be combined with genetic manipulations (knockouts, point mutations, controlled expression systems) to thoroughly characterize AaeA function in the native cellular context.

How can AaeA research inform broader understanding of bacterial adaptation?

Research on AaeA contributes to our understanding of bacterial adaptation through several important perspectives:

  • Environmental adaptation mechanisms:

    • Response to aromatic compounds in the environment

    • Protection against plant-derived antimicrobial substances

    • Adaptation to specific ecological niches

    • Role in managing metabolic byproducts

  • Stress response integration:

    • Connection to general stress response pathways

    • Coordination with other cellular defense systems

    • Role in managing oxidative stress through efflux of toxic compounds

    • Potential contribution to desiccation tolerance, similar to other transport systems in Salmonella

  • Host-pathogen interactions:

    • Potential role in colonization and infection

    • Protection against host-derived antimicrobial compounds

    • Contribution to survival in host microenvironments

    • Integration with virulence mechanisms

  • Evolutionary adaptability:

    • Sequence variations across Salmonella strains indicating selective pressures

    • Role of horizontal gene transfer in disseminating efflux determinants

    • Balance between substrate specificity and promiscuity

    • Adaptive mutations affecting regulation and function

  • System-level coordination:

    • Integration with global regulatory networks

    • Metabolic implications of efflux activity

    • Energy allocation trade-offs under stress conditions

    • Coordination with membrane homeostasis mechanisms

Studies on dehydration stress in Salmonella reveal that adaptation involves coordinated changes in gene expression, including transport systems that help maintain cellular homeostasis . Similarly, research on prophage elements demonstrates how bacterial genomes integrate foreign genetic material to enhance adaptive capabilities . AaeA likely participates in these complex adaptive networks, contributing to Salmonella's remarkable ability to persist in diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.