Recombinant Salmonella arizonae Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; SARI_03038; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLVYAWKAGRNTWWFAATLTVLGLFVILNITRYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIVLALVGVFGALGWILRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQTRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNAGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVTDPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDSKPNQS FSAVSCSQENIARFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPD IVRLWNFPKEMKAFTIDQDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQTVQHVDKTQWKGKTAFKD TVIDMQRYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPETWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTTTLHFNNP TDASTLVIAPPVPVSTNEGNILGHSPRKLGIGMVEIKVVNAES
Uniprot No.

Target Background

Function
This enzyme transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of phosphoglycerol transferase I (mdoB) in Salmonella arizonae?

Phosphoglycerol transferase I (mdoB) in S. arizonae, similar to its E. coli counterpart, functions as an enzyme localized in the inner cytoplasmic membrane. This enzyme catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides, resulting in phosphoglycerol diester derivatives and sn-1,2-diglyceride formation . The enzyme's active site is positioned on the outer aspect of the inner membrane, enabling it to interact with substrates in the periplasmic space. This positioning is critical for its role in membrane-derived oligosaccharide biosynthesis, which contributes to membrane integrity and potentially to pathogenicity mechanisms in Salmonella arizonae.

How does S. arizonae phosphoglycerol transferase I compare structurally and functionally to homologous enzymes in other enterobacteria?

While specific structural comparisons between S. arizonae and E. coli phosphoglycerol transferase I are not explicitly detailed in available literature, functional similarities can be inferred. In E. coli, the enzyme catalyzes phosphoglycerol transfer to membrane-derived oligosaccharides or model substrates like arbutin . The mdoB gene in both organisms likely encodes this enzymatic function, with mutations resulting in the absence of phosphoglycerol residues on membrane-derived oligosaccharides. The evolutionary relationship between these homologs may reflect the broader population structure of Salmonella enterica, which exhibits five distinct lineages with varying recombination patterns . This structural conservation across species suggests fundamental importance to bacterial membrane biology.

What are the optimal methods for isolating and expressing recombinant S. arizonae phosphoglycerol transferase I?

For successful isolation and expression of recombinant S. arizonae phosphoglycerol transferase I, researchers should consider:

  • Cloning strategy: The mdoB gene should be amplified from S. arizonae genomic DNA using primers designed based on conserved regions identified through alignment with E. coli and other Salmonella species.

  • Expression system: A bacterial expression system using E. coli BL21(DE3) or similar strains is recommended, with careful consideration of membrane protein expression challenges.

  • Purification approach: Since phosphoglycerol transferase I is a membrane-associated enzyme, detergent-based extraction methods are essential, typically using mild detergents like n-dodecyl-β-D-maltoside.

  • Activity verification: Enzyme activity can be confirmed using the arbutin assay, which measures phosphoglycerol transfer activity in vitro .

The choice of expression vector should include considerations for membrane protein targeting and solubility enhancement tags if necessary. Expression conditions, including temperature, induction timing, and media composition, should be optimized to maximize functional protein yield.

What experimental controls are critical when studying phosphoglycerol transferase I activity in S. arizonae?

When investigating phosphoglycerol transferase I activity in S. arizonae, several controls are essential:

  • Negative controls: Include mdoB mutant strains lacking phosphoglycerol transferase I activity. These mutants should be unable to transfer phosphoglycerol residues to arbutin or other substrates .

  • Positive controls: E. coli strains with well-characterized phosphoglycerol transferase I activity can serve as comparison standards.

  • Substrate specificity controls: Test enzyme activity with both natural (membrane-derived oligosaccharides) and model substrates (arbutin).

  • Enzymatic reaction controls: Include reactions without enzyme, without substrate, and with heat-inactivated enzyme to ensure specificity.

  • In vivo validation: Complement mdoB mutant strains with the recombinant S. arizonae mdoB gene to confirm functional restoration.

These controls help distinguish true enzymatic activity from potential artifacts and provide validation for the specificity of the observed reactions.

How can recombinant S. arizonae phosphoglycerol transferase I be utilized in vaccine development research?

Recombinant S. arizonae phosphoglycerol transferase I offers several potential applications in vaccine development:

  • Antigen delivery system: Modified Salmonella strains with regulated mdoB expression could serve as vectors for antigen delivery, building on established methods for using Salmonella as vaccine vectors .

  • Membrane engineering: Manipulation of phosphoglycerol transferase I activity could alter membrane properties, potentially enhancing the immunogenicity of Salmonella-based vaccines.

  • Biological containment: Regulated expression of mdoB could be incorporated into biological containment strategies for live attenuated Salmonella vaccines, similar to the programmed lysis systems developed at Arizona State University .

  • Cross-protective immunity: Conserved epitopes of phosphoglycerol transferase I across Salmonella species might potentially elicit broader protective responses.

The ASU researchers' work on regulated programmed lysis of recombinant Salmonella demonstrates how engineered bacteria can effectively deliver antigens without causing infection, a concept that could be extended through mdoB manipulation .

What is the potential role of phosphoglycerol transferase I in S. arizonae pathogenicity, particularly in immunocompromised hosts?

Phosphoglycerol transferase I likely contributes to S. arizonae pathogenicity through several mechanisms:

  • Membrane integrity: By modifying membrane-derived oligosaccharides with phosphoglycerol residues, this enzyme may enhance bacterial survival under host stress conditions.

  • Immune evasion: Modifications to surface oligosaccharides could affect recognition by host immune components.

  • Stress response: Membrane composition alterations mediated by phosphoglycerol transferase I may contribute to adaptation during host colonization.

  • Host-specific virulence: In immunocompromised hosts, where S. arizonae infections can become severe , these membrane modifications might play an enhanced role in pathogenicity.

S. arizonae infections primarily affect immunocompromised individuals and infants with a history of reptile exposure . The manifestations range from gastroenteritis to more severe conditions like bacteremia, meningitis, and osteomyelitis . Understanding phosphoglycerol transferase I's role in pathogenicity could inform therapeutic approaches for these vulnerable populations.

What are the common challenges in measuring phosphoglycerol transferase I activity and how can they be addressed?

Researchers face several challenges when measuring phosphoglycerol transferase I activity:

ChallengeTechnical ImpactRecommended Solution
Membrane associationDifficulty in obtaining pure, active enzymeUse detergent-based extraction with activity verification at each purification step
Low natural expressionInsufficient yields for biochemical studiesDevelop optimized recombinant expression systems with inducible promoters
In vitro vs. in vivo activityEnzymatic behavior may differ in artificial systemsComplement activity assays with in vivo studies using mdoB mutants
Substrate availabilityNatural substrates may be difficult to isolateUtilize model substrates like arbutin for initial characterization
Assay sensitivityDetecting low-level enzymatic activityDevelop fluorescent or radioactive-based assays with higher sensitivity

To address these challenges, researchers should employ a multi-faceted approach combining genetic, biochemical, and structural methods. The arbutin assay provides a valuable starting point, as demonstrated in E. coli studies where arbutin-resistant strains were used to identify mdoB mutations .

How can researchers differentiate between the effects of phosphoglycerol transferase I activity and other membrane modification enzymes in S. arizonae?

Differentiating between phosphoglycerol transferase I and other membrane modification enzymes requires:

  • Genetic approach: Generate specific mdoB knockout mutants in S. arizonae using techniques like CRISPR-Cas9 or homologous recombination.

  • Biochemical profiling: Compare membrane oligosaccharide compositions between wild-type and mdoB mutant strains using techniques like mass spectrometry.

  • Substrate specificity assays: Conduct in vitro assays with purified enzymes and various substrates to determine specificity profiles.

  • Structural biology: Determine the three-dimensional structure of S. arizonae phosphoglycerol transferase I to identify unique features.

  • Complementation studies: Express different membrane modification enzymes in mdoB-deficient backgrounds to assess functional overlap.

This systematic approach allows researchers to isolate the specific effects of phosphoglycerol transferase I from other membrane-modifying activities, which is essential for understanding its unique contributions to bacterial physiology and pathogenicity.

How has phosphoglycerol transferase I evolved across the different lineages of Salmonella enterica, and what implications does this have for S. arizonae research?

The evolution of phosphoglycerol transferase I across Salmonella lineages likely reflects the broader evolutionary patterns observed in S. enterica. Analysis of S. enterica population structure reveals five distinct lineages, with one lineage being significantly older than the others—approximately five times the age of the other four and two-thirds the age of the entire subspecies . This evolutionary divergence is accompanied by varying degrees of recombination between lineages, with some showing higher recombination rates than others .

For S. arizonae research, these evolutionary patterns suggest:

  • Functional conservation: Core functions of phosphoglycerol transferase I are likely conserved across lineages despite sequence variations.

  • Subspecies adaptations: Specific modifications to enzyme function may have evolved to support S. arizonae's ecological niche (primarily reptiles).

  • Recombination effects: The pattern of "sexual isolation" between lineages may have influenced the independent evolution of phosphoglycerol transferase I variants.

  • Horizontal gene transfer: Potential exchange of mdoB gene variants between closely related lineages but limited transfer between distant lineages.

Understanding these evolutionary relationships provides context for interpreting functional differences in phosphoglycerol transferase I across Salmonella subspecies.

What genomic and proteomic approaches are most effective for studying the evolution of mdoB genes across Salmonella species?

To effectively study mdoB gene evolution across Salmonella species, researchers should combine:

  • Comparative genomics: Sequence analysis of mdoB genes across multiple Salmonella isolates representing diverse lineages, similar to the approach used to identify the five major lineages within S. enterica .

  • Phylogenetic analysis: Construction of mdoB-specific phylogenies to trace evolutionary relationships and detect potential horizontal gene transfer events.

  • Selection analysis: Calculation of dN/dS ratios to identify regions under purifying or positive selection, indicating functional constraints or adaptive evolution.

  • Structural proteomics: Homology modeling of phosphoglycerol transferase I proteins from different species to identify structurally conserved domains.

  • Functional genomics: Transcriptomic analysis to identify lineage-specific expression patterns and regulatory mechanisms.

These approaches can be integrated with the population structure analysis methods (Structure and ClonalFrame) that have successfully revealed recombination patterns in S. enterica , providing a comprehensive view of mdoB evolution in the context of broader species diversification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.