Recombinant Salmonella arizonae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnF; SARI_00596; Putative 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
arnF
Target Protein Sequence
MGVMWGLISVAIASLAQLSLGFSMMRLPSIAHPLAFIAGLGAFTTATLALFAGLAGYLIP VSCWQKTLHSLALSKTYALLSLSYVLVRVVTRSVRRFLSKSDARRIVHCGGDNADFPARQ LMMACASTAAIRRRNNIEH
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella arizonae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF?

Recombinant Salmonella arizonae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF is a membrane protein component that functions as part of the bacterial lipopolysaccharide modification machinery. The protein consists of 139 amino acids and serves as a subunit of the flippase involved in translocating 4-amino-4-deoxy-L-arabinose (L-Ara4N) across the bacterial inner membrane . This protein plays a critical role in bacterial resistance to cationic antimicrobial peptides and certain antibiotics. When produced recombinantly, the protein is typically expressed with an N-terminal His-tag in E. coli expression systems to facilitate purification while maintaining its structural integrity .

What is the biological function of arnF in bacterial systems?

The arnF protein functions as a critical component in bacterial antibiotic resistance mechanisms. Specifically, it serves as a subunit of the undecaprenyl phosphate-aminoarabinose flippase complex, which translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (L-Ara4N) from the cytoplasmic to the periplasmic face of the bacterial inner membrane . This translocation is a crucial step in the modification of lipopolysaccharide (LPS) with L-Ara4N, which reduces the negative charge of the bacterial outer membrane, consequently decreasing the binding affinity of cationic antimicrobial peptides and antibiotics like polymyxin. The modification pathway arnF participates in represents one of the major adaptive resistance mechanisms employed by gram-negative bacteria against host defense peptides and clinical antibiotics.

What expression systems are optimal for recombinant arnF production?

Escherichia coli is the primary expression system for recombinant arnF production, with demonstrated success in expressing the full-length protein with an N-terminal His-tag . For optimal expression of this membrane protein, specialized E. coli strains should be considered. These include C41(DE3) and C43(DE3) strains, which were specifically evolved for membrane protein expression, and Lemo21(DE3), which allows tunable expression through T7 lysozyme regulation. The Rosetta strain series may be particularly valuable as they supply rare tRNAs that might be necessary for efficient translation of Salmonella sequences in E. coli hosts .

Expression vectors should incorporate strong but controllable promoters, such as T7 with lac operator control, allowing for induction when cell density reaches optimal levels. Fusion tags beyond the His-tag, such as MBP (maltose-binding protein) or SUMO, may improve solubility and expression levels. For more challenging expression scenarios, alternative systems such as cell-free expression platforms or eukaryotic hosts like Pichia pastoris could be explored, though these would require significant protocol adaptations.

How can the expression yield of recombinant arnF be optimized?

Optimizing the expression yield of recombinant arnF requires addressing several key factors that influence protein production efficiency. Research shows that the accessibility of translation initiation sites significantly impacts successful protein expression, with the region spanning positions -24 to +24 relative to the start codon being particularly critical . Tools like TIsigner can strategically modify the first nine codons with synonymous substitutions to improve mRNA accessibility without altering the protein sequence .

Temperature management represents another critical factor, with lower expression temperatures (16-25°C) often yielding better results for membrane proteins by slowing folding and preventing aggregation. The induction protocol should be carefully optimized, typically using lower inducer concentrations (0.1-0.5 mM IPTG) and inducing at mid-log phase (OD600 of 0.6-0.8) . Comparative data on optimization parameters shows:

Optimization ParameterEffect on ExpressionImplementation Strategy
Translation initiation site accessibilityHighest correlation with expression success (Rs = -0.65) Synonymous codon optimization of first 9 codons
Growth temperatureCritical for proper foldingReduce to 16-25°C post-induction
Inducer concentrationImpacts protein qualityUse 0.1-0.5 mM IPTG rather than standard 1.0 mM
Media compositionAffects biomass and protein yieldRich media (TB, SB) for higher yields
Expression durationAffects total yield18-24 hours at reduced temperature

Stochastic simulation models confirm that optimizing translation initiation accessibility leads to higher protein production, though potentially at the cost of slower cell growth when overexpressed .

What purification strategies are most effective for isolating functional arnF protein?

Purifying membrane proteins like arnF requires specialized approaches that maintain the protein's native structure and function throughout isolation. A comprehensive purification strategy typically involves multiple steps, beginning with careful cell lysis using either sonication or high-pressure homogenization in the presence of protease inhibitors to prevent degradation . The membrane fraction containing arnF must be isolated through differential centrifugation steps, followed by solubilization using appropriate detergents that effectively extract the protein while preserving its structural integrity.

For His-tagged recombinant arnF, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin represents the primary purification method . The binding buffer should contain the selected detergent at concentrations above its critical micelle concentration (CMC), typically with low imidazole concentrations (10-20 mM) to reduce non-specific binding. Washing with increasing imidazole concentrations (40-60 mM) removes contaminants before elution with high imidazole (250-500 mM) . Further purification through size exclusion chromatography separates monomeric protein from aggregates and removes additional contaminants.

Throughout the purification process, protein quality should be assessed using SDS-PAGE, with purity typically exceeding 90% for research applications . The purified protein is best stored in a buffer containing 6% trehalose at pH 8.0 as a lyophilized powder or in aliquots at -80°C to prevent repeated freeze-thaw cycles .

How can mRNA accessibility optimization improve arnF expression?

Optimizing mRNA accessibility represents a powerful strategy for improving recombinant arnF expression. Recent research analyzing 11,430 recombinant proteins has demonstrated that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across Boltzmann's ensemble, significantly outperforms alternative features in predicting expression success . The correlation between opening energies of translation initiation sites (positions -30 to 18) and protein abundance shows a Spearman's correlation of Rs = -0.65 (P < 2.2 × 10^-16), substantially stronger than traditional metrics like the Codon Adaptation Index .

This approach can be methodically applied to arnF expression through the following steps:

  • Calculate the current opening energy of the translation initiation region (-24:24) using computational tools like RNAplfold from the Vienna RNA package.

  • Apply TIsigner or similar algorithms that use simulated annealing to introduce synonymous substitutions in the first nine codons, optimizing accessibility without altering the protein sequence .

  • Generate multiple optimization variants with progressively lower opening energies.

  • Experimentally test these variants under identical expression conditions to determine which demonstrates the highest yield.

The research data indicates that optimizing this single parameter could potentially increase expression success probability from approximately 50% (the average failure rate for recombinant proteins) to a much higher level . Importantly, this approach requires modifying only a small portion of the gene while maintaining the complete integrity of the protein sequence.

What methodological approaches can characterize arnF's role in antibiotic resistance?

Investigating arnF's role in antibiotic resistance requires a multifaceted experimental approach combining genetic, biochemical, and microbiological methods. A comprehensive research strategy would include:

  • Gene disruption studies: Creating precise ΔarnF knockout mutants using CRISPR-Cas9 or traditional homologous recombination methods. These mutants should be phenotypically characterized through antibiotic susceptibility testing (determining Minimum Inhibitory Concentrations) against polymyxins, cationic antimicrobial peptides, and other relevant antibiotics. Complementation with wild-type arnF should restore resistance if the gene is directly involved .

  • Lipopolysaccharide modification analysis: Extracting and analyzing LPS from wild-type and ΔarnF mutants using mass spectrometry to quantify L-Ara4N modification levels. This would provide direct evidence of arnF's role in the LPS modification pathway.

  • Structure-function relationship mapping: Performing site-directed mutagenesis of conserved residues identified through sequence alignment and structural prediction models . Testing these mutants' ability to complement resistance phenotypes would identify critical functional domains within the protein.

  • Flippase activity assays: Developing in vitro assays using purified recombinant arnF reconstituted into liposomes to directly measure L-Ara4N-phosphoundecaprenol flipping activity. Fluorescently labeled substrate analogs could enable real-time monitoring of transport activity.

  • Protein interaction studies: Identifying other components of the flippase complex and regulatory proteins through approaches like bacterial two-hybrid systems adapted for membrane proteins or in vivo crosslinking followed by mass spectrometry.

This systematic approach would provide comprehensive insights into arnF's mechanistic role in antibiotic resistance, potentially identifying new targets for adjuvant therapies designed to overcome this resistance mechanism.

What structural analysis techniques are most appropriate for studying arnF?

The structural characterization of membrane proteins like arnF requires specialized techniques that accommodate their hydrophobic nature and reliance on the lipid environment. A comprehensive structural analysis approach would involve:

  • Cryo-Electron Microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology, allowing visualization of proteins in near-native environments. For arnF, incorporation into nanodiscs or amphipol systems would preserve the membrane environment while enabling single-particle analysis. The relatively small size of arnF (139 amino acids) presents challenges but could be addressed by studying larger complexes containing arnF .

  • X-ray Crystallography: Though challenging for membrane proteins, this approach can yield high-resolution structures. For arnF, crystallization in lipidic cubic phases or with the addition of crystallization chaperones (such as antibody fragments) may increase success probability. Screening multiple detergents and crystallization conditions is essential.

  • Nuclear Magnetic Resonance (NMR): Solution NMR could be suitable for studying individual domains of arnF, while solid-state NMR might be applicable to the full-length protein in membrane mimetics. This approach requires isotopic labeling (^15N, ^13C) during recombinant expression.

  • Computational Modeling with Experimental Validation: Starting with AlphaFold predictions (which show relatively high confidence for this protein with a global pLDDT score of 79.85) , refine models using experimental data from techniques like crosslinking mass spectrometry or electron paramagnetic resonance (EPR) spectroscopy.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides valuable information on protein dynamics and solvent accessibility without requiring crystallization, offering insights into functional regions and conformational changes upon substrate binding.

The integration of multiple complementary techniques would provide the most comprehensive structural understanding of arnF, particularly when combined with functional assays that correlate structural features with biological activity.

How can molecular dynamics simulations enhance understanding of arnF function?

Molecular dynamics (MD) simulations offer powerful insights into membrane protein function that complement experimental approaches. For arnF, MD simulations can elucidate dynamic aspects of its flippase activity through several methodological approaches:

  • Membrane embedding and equilibration: Beginning with the AlphaFold-predicted structure (pLDDT score 79.85) , the protein should be embedded in a realistic membrane bilayer composed of phospholipids representative of bacterial inner membranes. This system must be equilibrated to ensure stable protein-membrane interactions before productive simulations.

  • Substrate binding site identification: Docking simulations with the L-Ara4N-phosphoundecaprenol substrate can identify potential binding sites and key interacting residues. These predictions can guide mutagenesis experiments for functional validation.

  • Transport mechanism elucidation: Extended simulations (reaching microsecond timescales) may capture conformational changes associated with the flipping mechanism. Advanced sampling techniques like steered MD or umbrella sampling can help overcome energy barriers to observe the complete transport process.

  • Lipid-protein interactions: Analyzing specific lipid interactions throughout simulations can reveal lipid binding sites that might be essential for function or stability, potentially identifying lipid specificity of the flippase activity.

  • Effect of mutations: Simulating arnF variants with mutations in conserved residues can predict their impact on protein stability and function before experimental testing, streamlining the mutagenesis process.

The simulation parameters should include appropriate force fields optimized for membrane systems (such as CHARMM36 or AMBER Lipid17), explicit solvent, physiological ion concentrations, and temperature control at 310K. Analysis should focus on protein conformational changes, water penetration into the protein core, and energetics of substrate movement across the membrane.

Why might recombinant arnF fail to express in E. coli systems?

Membrane proteins like arnF frequently encounter expression challenges, with approximately 50% of recombinant proteins failing to express successfully in host cells . Several specific factors may contribute to arnF expression failure:

  • Suboptimal translation initiation: Research demonstrates that the accessibility of translation initiation sites (particularly positions -30 to 18) strongly correlates with expression success . For arnF, secondary structures in this region could impede ribosome binding and translation initiation. This can be addressed by synonymous codon optimization of the first 9 codons using computational tools like TIsigner that specifically target mRNA accessibility .

  • Toxicity to host cells: Overexpression of membrane proteins often disrupts host cell membrane integrity or overwhelms membrane insertion machinery. This toxicity manifests as growth arrest after induction. Mitigation strategies include using specialized E. coli strains like C41(DE3) genetically adapted for membrane protein expression, reducing expression temperature to 16-25°C, and using weaker promoters or lower inducer concentrations.

  • Protein aggregation and inclusion body formation: Improperly folded arnF may aggregate in the cytoplasm rather than inserting into membranes. This can be detected through fractionation studies and Western blotting. Potential solutions include co-expression with chaperones, fusion to solubility-enhancing partners like MBP, and optimizing membrane targeting through signal sequence modifications.

  • Proteolytic degradation: Unstable or misfolded protein may be rapidly degraded by host proteases. This is typically observed as weak or absent bands on Western blots despite confirmed mRNA expression. Using protease-deficient strains and optimizing growth conditions to promote proper folding can address this issue.

  • Codon usage bias: Rare codons in the Salmonella sequence may cause translational pausing and incomplete protein synthesis. Codon optimization for E. coli expression or using Rosetta strains providing rare tRNAs can overcome this limitation.

Systematic troubleshooting should involve generating multiple expression constructs with variations in tags, fusion partners, and codon optimization strategies, then testing them across different host strains, media compositions, and induction conditions.

What methods can assess proper folding and functionality of purified arnF?

Confirming proper folding and functionality of purified recombinant arnF requires multiple complementary analytical approaches:

  • Circular Dichroism (CD) Spectroscopy: As a membrane protein with predicted alpha-helical transmembrane domains, properly folded arnF should show characteristic CD spectra with minima at 208 nm and 222 nm. Thermal denaturation studies can further assess structural stability, with well-folded protein showing cooperative unfolding transitions.

  • Size Exclusion Chromatography (SEC): Properly folded membrane proteins should elute as monodisperse peaks consistent with their expected size plus the detergent micelle. Multiple peaks or elution in the void volume suggests aggregation or improper folding. SEC coupled with multi-angle light scattering (SEC-MALS) can determine precise oligomeric states.

  • Intrinsic Fluorescence Spectroscopy: Changes in the local environment of tryptophan residues can indicate proper tertiary structure formation. Comparing fluorescence emission spectra before and after thermal denaturation provides insights into structural integrity.

  • Limited Proteolysis: Well-folded membrane proteins show characteristic proteolytic patterns with protected transmembrane domains. Time-course digestion with proteases like trypsin followed by mass spectrometry analysis can map accessible regions versus protected domains.

  • Functional Reconstitution: The ultimate test of functionality involves reconstituting purified arnF into liposomes and measuring flippase activity. This could be accomplished by incorporating fluorescently labeled L-Ara4N analogs into liposomes and monitoring their translocation. Alternatively, complementation of arnF-deficient bacterial strains should restore polymyxin resistance if the protein is properly folded and functional.

  • Binding Assays: Surface plasmon resonance (SPR) or microscale thermophoresis (MST) can assess binding to known interaction partners or substrates, providing quantitative measures of functionality through binding kinetics and affinity constants.

These methodologies collectively provide a comprehensive assessment of both structural integrity and functional activity, essential for ensuring that purified recombinant arnF retains its native properties.

What strategies can overcome membrane protein crystallization challenges for arnF structural studies?

Crystallizing membrane proteins like arnF presents significant challenges that require specialized approaches beyond conventional protein crystallization methods. A systematic strategy to overcome these challenges includes:

  • Construct Optimization: Creating multiple constructs with variable N- and C-terminal boundaries can identify more crystallizable versions. Removing flexible regions while preserving core structure often improves crystallization probability. For arnF, bioinformatic analysis can identify potential disordered regions that could be truncated without affecting core structure .

  • Detergent Screening: The choice of detergent critically impacts crystallization success. A hierarchical screening approach should test at least 10-12 different detergents spanning various head groups and chain lengths (e.g., DDM, DM, LDAO, CYMAL-6, UDM). Detergent stability should be assessed by monitoring monodispersity on size exclusion chromatography over time.

  • Lipidic Cubic Phase (LCP) Crystallization: This method maintains a more native-like environment for membrane proteins. For arnF, monoolein-based LCP systems with various additives like cholesterol or specific phospholipids should be evaluated. Specialized LCP dispensing equipment allows high-throughput screening of crystallization conditions.

  • Crystallization Chaperones: Fusion with or co-crystallization alongside antibody fragments (Fab, scFv) or crystallization chaperones like T4 lysozyme can provide additional crystal contacts. These approaches have proven particularly successful for small membrane proteins similar to arnF.

  • Surface Engineering: Introducing surface mutations that reduce entropy (e.g., replacing flexible lysine or glutamate residues with alanine) in non-conserved, solvent-exposed regions can promote crystal contact formation without affecting protein function.

  • Alternative Crystallization Formats: Bicelle crystallization, which combines aspects of detergent solubilization and lipid bilayers, provides another option. For arnF, DMPC/CHAPSO bicelles at ratios of 2.8-3.2:1 represent a good starting point.

Implementing this systematic approach with comprehensive condition screening (temperature, pH, precipitants, additives) maximizes the probability of obtaining diffraction-quality crystals for structural determination of arnF.

How can researchers design experiments to study arnF interactions with other membrane components?

Investigating the interactions of arnF with other membrane components requires specialized approaches that account for the membrane environment. A comprehensive experimental design would include:

  • Bacterial Two-Hybrid Systems Adapted for Membrane Proteins: These genetic approaches, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid) or MYTH (Membrane Yeast Two-Hybrid), allow screening for protein-protein interactions involving membrane proteins. For arnF, fusion constructs with the T18 and T25 fragments of adenylate cyclase can be generated and co-expressed in reporter strains to identify interaction partners from genomic libraries or candidate proteins.

  • In Vivo Crosslinking Coupled with Mass Spectrometry: Incorporating photo-activatable or chemical crosslinkers directly into bacteria expressing arnF allows capture of native interaction complexes. After crosslinking, purification under denaturing conditions followed by mass spectrometry analysis can identify interaction partners. For higher specificity, site-directed incorporation of photo-crosslinkable amino acids at specific positions in arnF can map interaction interfaces.

  • Co-Purification Studies: Tandem affinity purification using differently tagged components of the putative flippase complex can confirm stable interactions. Sequential purification steps (e.g., Ni-NTA followed by Strep-Tactin) under gentle solubilization conditions preserve physiologically relevant interactions.

  • Proximity Labeling Approaches: Fusing arnF to enzymes like BioID (biotin ligase) or APEX2 (ascorbate peroxidase) enables proximity-dependent labeling of neighboring proteins in the native membrane environment. These approaches identify not only direct interactors but also proteins in close proximity within the membrane, providing a more comprehensive view of the protein's neighborhood.

  • Fluorescence Resonance Energy Transfer (FRET): For specific hypothesized interactions, FRET pairs can be incorporated into arnF and potential partners. This approach works in both in vivo systems with fluorescent protein fusions and in vitro with reconstituted proteins labeled with appropriate fluorophores.

  • Liposome Reconstitution Assays: Co-reconstituting purified arnF with putative partner proteins in liposomes allows functional studies of the reconstituted complex. Activity measurements comparing arnF alone versus the reconstituted complex can provide functional validation of biologically relevant interactions.

These complementary approaches provide both screening capacity to discover new interactions and validation methods to confirm and characterize specific interactions, ultimately building a comprehensive interaction network around arnF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.