Recombinant Salmonella arizonae Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Role in Bacterial Physiology

  • Septation and Cell Division: YciB facilitates intracellular septation, a critical process for bacterial replication. In S. Typhimurium, the YciF homolog forms oligomers and binds iron, which is essential for mitigating oxidative stress during bile exposure .

  • Iron Homeostasis: The DUF892 domain in YciB homologs exhibits ferroxidase activity, enabling iron sequestration to prevent reactive oxygen species (ROS)-mediated damage .

Virulence and Pathogenicity

  • S. arizonae retains pathogenicity islands (SPI-1, SPI-2) but lacks effectors like sipA and ssaG found in other Salmonella subspecies . YciB’s role in virulence remains uncharacterized but may intersect with stress response pathways critical for host colonization.

Expression and Purification

  • Host Systems: Recombinant YciB is typically expressed in E. coli or Salmonella vectors (e.g., Asd+ plasmid pYA3337) .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

Experimental Use Cases

ApplicationProtocol Details
ELISA/Western BlotDetected using anti-His tag antibodies; used for antigen-antibody interaction studies .
Stress Response StudiesEvaluated in S. Typhimurium ΔcspE mutants to rescue bile-induced oxidative stress .

S. arizonae vs. Other Salmonella Subspecies

FeatureS. arizonaeS. Typhimurium
SPI-1/SPI-2 EffectorsAbsent (e.g., sipA, ssaG)Present
Iron RegulationLikely conserved (via DUF892 domain)Confirmed (YciF ferroxidase activity)
Serovar Diversity46 serovars; 30% polyphyletic>1,500 serovars; ~10% polyphyletic

Key Knowledge Gaps

  • Direct functional studies on S. arizonae YciB are lacking. Current data rely on homologs like S. Typhimurium YciF .

  • The protein’s interaction with S. arizonae-specific virulence factors (e.g., SPI-20-encoded T6SS) remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; SARI_01219; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLMSQWVMKKPLIQRMLGKELALPQQIWSKLN LAWALFFIVCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.

Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella arizonae and why is it significant for evolutionary studies?

Salmonella arizonae (also called Salmonella subgroup IIIa) is a Gram-negative, non-spore-forming, motile, rod-shaped, facultatively anaerobic bacterium. It holds significant evolutionary importance because it occupies a position between Salmonella subgroup I (human pathogens) and subgroup V (S. bongori; usually non-pathogenic to humans). This intermediate evolutionary position makes S. arizonae an ideal model organism for studying bacterial evolution, particularly the transition from non-human pathogens to human pathogens . Phylogenetic analysis using concatenated sequences of 945 genes common to 25 sequenced strains showed that S. arizonae RKS2983 is positioned between Salmonella subgroup I and S. bongori, confirming its evolutionary significance .

What is the biological function of intracellular septation protein A (yciB)?

The intracellular septation protein A (yciB) is an inner membrane-spanning protein that plays a crucial role in maintaining cell envelope integrity. Research has demonstrated that yciB functions synergistically with the inner membrane lipoprotein DcrB. This protein is essential for proper lipoprotein maturation and localization, particularly affecting the first step of lipoprotein lipid modification . When yciB is defective along with DcrB, it causes the outer membrane lipoprotein Lpp to mislocalize to the inner membrane, where it forms toxic linkages to peptidoglycan, compromising cellular integrity . The yciB protein appears to influence membrane fluidity and phospholipid homeostasis, which are critical for the proper functioning of lipoprotein maturation enzymes .

How does yciB interact with other proteins in the bacterial cell envelope?

The yciB protein demonstrates essential synergistic interactions with DcrB, an inner membrane lipoprotein. This interaction is critical for maintaining proper cell envelope structure and function. When both yciB and DcrB are defective (yciB dcrB double mutant), the phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase (Lgt), which catalyzes the initial step in lipoprotein maturation, functions inefficiently . This leads to incomplete lipid modification of lipoproteins like Lpp. Additionally, the yciB dcrB double mutant activates both Cpx and Rcs envelope stress response signaling systems, with Rcs activation primarily mediated by the accumulation of RcsF at the inner membrane . Interestingly, Cpx upregulation occurs independently of NlpE, suggesting complex regulatory interactions beyond direct protein-protein contacts .

What are the molecular mechanisms underlying yciB's role in lipoprotein maturation?

The molecular mechanisms by which yciB affects lipoprotein maturation involve complex interactions with membrane components that influence enzyme function. Research indicates that yciB deficiency, particularly when combined with dcrB mutation, leads to attenuated Lgt-mediated transacylation, which is the first step in lipoprotein maturation . This is not a consequence of lowered phosphatidylglycerol levels but rather appears to be related to altered membrane fluidity or lipid homeostasis . The yciB protein likely influences membrane biophysical properties that are crucial for optimal Lgt function. Supporting this hypothesis, dcrB null mutants show temperature-dependent viability issues, being non-viable when grown at low temperatures, which are known to affect membrane fluidity . This suggests that yciB and DcrB may work together to maintain optimal membrane conditions for lipoprotein processing enzymes.

How does the evolutionary position of S. arizonae inform our understanding of yciB function across Salmonella species?

The evolutionary position of S. arizonae between pathogenic and non-pathogenic Salmonella lineages provides valuable insights into the functional evolution of proteins like yciB. Genomic analysis of S. arizonae RKS2983 revealed 2,823 genes common to S. arizonae, S. bongori, and S. typhimurium LT2 (representing Salmonella subgroup I), with 926 genes specific to RKS2983 . The distribution of Salmonella pathogenicity islands (SPIs) is particularly informative - S. arizonae shares some SPIs with S. bongori and others with S. typhimurium or S. typhi . This mosaic pattern suggests that yciB function may have evolved in parallel with virulence mechanisms during Salmonella adaptation to different hosts. Analysis of the core genome and specific genetic elements unique to different evolutionary lineages can elucidate how yciB's role in membrane integrity may have been adapted or conserved during the evolution of host specificity and pathogenicity.

What are the implications of yciB-DcrB interaction for bacterial stress response systems?

The synergistic relationship between yciB and DcrB has significant implications for bacterial stress response mechanisms. Research shows that in yciB dcrB double mutants, both Cpx and Rcs envelope stress response (ESR) systems are upregulated . The Rcs activation appears to be primarily mediated by the accumulation of RcsF at the inner membrane, while Cpx upregulation occurs independently of NlpE . This differential activation suggests that these proteins influence distinct stress response pathways. Interestingly, the yciB single mutant already shows high Cpx activity without detectable levels of incompletely modified lipoproteins or high Rcs activity, indicating that yciB affects Cpx signaling through mechanisms beyond lipoprotein maturation defects . This complex interplay between membrane proteins and stress response systems reveals sophisticated bacterial adaptation mechanisms that could be targeted in future antimicrobial strategies.

What techniques are most effective for studying yciB function in Salmonella arizonae?

For studying yciB function in Salmonella arizonae, a multi-faceted approach combining genetic, biochemical, and biophysical techniques is most effective. Genetic approaches should include:

  • Generation of clean knockout mutants using Lambda Red recombination or CRISPR-Cas9 systems

  • Complementation studies with wild-type and mutated yciB constructs

  • Construction of double/multiple mutants with interacting partners like dcrB

Biochemical approaches should focus on:

  • Membrane protein extraction and purification using detergent solubilization

  • Assessment of lipoprotein maturation using pulse-chase experiments with radiolabeled amino acids

  • Analysis of lipid modifications using mass spectrometry

Biophysical techniques to assess membrane properties include:

  • Fluorescence anisotropy to measure membrane fluidity

  • Differential scanning calorimetry to assess lipid phase transitions

  • Atomic force microscopy to visualize membrane structure

These methodologies, when combined, can provide comprehensive insights into yciB function and its role in maintaining membrane integrity and proper protein localization .

How can researchers effectively analyze envelope stress responses related to yciB dysfunction?

Analyzing envelope stress responses related to yciB dysfunction requires a systematic approach focusing on specific reporter systems and physiological changes. The following methodological framework is recommended:

Table 1: Methodological Approaches for Studying Envelope Stress Responses

MethodApplicationMeasurable ParameterReference
β-galactosidase reporter assaysMonitoring Cpx and Rcs pathway activationTranscriptional activity of stress response genes
qRT-PCRQuantifying expression of stress response genesmRNA levels of key stress response mediators
Western blottingDetecting protein levels and modificationsAbundance and processing of lipoproteins like Lpp
Membrane vesiculation assaysAssessing envelope integrityRate and composition of outer membrane vesicles
Fluorescence microscopy with protein localization markersVisualizing protein mislocationSubcellular distribution of fluorescently tagged proteins

For the most comprehensive analysis, researchers should implement time-course experiments following induction of yciB and/or dcrB mutations to track the dynamics of stress response activation. Additionally, employing RNA-seq can provide a global view of transcriptional changes associated with envelope stress responses, potentially revealing novel components of these pathways affected by yciB dysfunction .

What genomic and phylogenetic approaches are valuable for studying yciB evolution in Salmonella species?

To effectively study yciB evolution across Salmonella species, researchers should employ a combination of comparative genomics, phylogenetics, and functional genomics. The recommended methodology includes:

  • Whole Genome Sequencing and Alignment:

    • Sequence multiple strains representing different Salmonella subspecies

    • Perform whole-genome alignment using tools like MAFFT to identify conserved regions and variations

    • Focus on identifying syntenic regions surrounding yciB

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using concatenated sequences of core genes (similar to the approach used with 945 common genes)

    • Employ both Neighbor-Joining and Maximum Likelihood methods to ensure robust evolutionary inference

    • Use MEGA software with 1,000 bootstrap replicates for statistical confidence

  • Gene Content Analysis:

    • Compare yciB gene presence/absence and variation across Salmonella lineages

    • Identify co-evolving gene clusters that may functionally interact with yciB

    • Analyze core gene data between different Salmonella subspecies as demonstrated in the comparison of S. arizonae RKS2983, S. bongori NCTC 12419, and S. typhimurium LT2

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to determine selective pressure on yciB across lineages

    • Identify positively selected sites that may relate to host adaptation

This integrated approach can reveal how yciB has evolved during Salmonella diversification and adaptation to different ecological niches, potentially identifying lineage-specific functional adaptations .

How might yciB be exploited for vaccine delivery platforms?

Research into yciB function might contribute to novel vaccine delivery platforms using attenuated Salmonella. Building on existing research that uses Salmonella for antigen delivery , the manipulation of yciB and its interaction partners could enhance vaccine efficacy through several mechanisms:

  • Controlled Envelope Integrity: Modifying yciB expression or function could fine-tune membrane permeability, potentially enhancing controlled release of antigens within host tissues .

  • Regulated Lysis Systems: Since yciB affects cell envelope integrity, engineered Salmonella with modified yciB activity could be designed to undergo programmed lysis after reaching target tissues, similar to the regulated programmed lysis system described for recombinant Salmonella .

  • Improved Biological Containment: Understanding yciB's role in envelope integrity could facilitate the development of conditional lethality systems that ensure vaccine strains don't persist in the environment .

  • Enhanced Immunogenicity: By controlling lipoprotein processing and localization through yciB manipulation, researchers might enhance the presentation of specific antigens to the immune system, potentially improving vaccine efficacy .

These approaches would require careful genetic engineering to ensure both safety and efficacy, but they represent promising directions for exploiting yciB biology in vaccine development.

What potential therapeutic targets might emerge from further understanding of yciB and lipoprotein maturation pathways?

Further research into yciB and lipoprotein maturation pathways could reveal novel therapeutic targets for antimicrobial development. Several promising avenues include:

  • Targeting Lgt Function in Pathogenic Bacteria: Since yciB affects Lgt-mediated transacylation in lipoprotein maturation, compounds that selectively modulate this process could disrupt bacterial envelope integrity .

  • Synthetic Lethality Approaches: The synthetic lethality observed in yciB dcrB double mutants suggests that simultaneous targeting of redundant pathways could be an effective antibacterial strategy, potentially overcoming resistance mechanisms .

  • Stress Response Modulators: The activation of Cpx and Rcs stress response systems in yciB dcrB mutants indicates that molecules that artificially trigger these responses might induce bacterial self-destruction mechanisms .

  • Membrane Fluidity Disruptors: Given the connection between yciB function and membrane fluidity, compounds that specifically alter the fluidity of bacterial membranes could disrupt lipoprotein maturation and envelope integrity .

  • Host-Adaptation Interference: The evolutionary position of S. arizonae suggests that targeting yciB function might interfere with adaptation to specific hosts, potentially reducing virulence or transmission .

These potential therapeutic approaches would require extensive validation but represent promising directions based on our current understanding of yciB biology and its role in bacterial envelope maintenance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.