Recombinant Salmonella arizonae Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol (PG) to the sulfhydryl group of a conserved cysteine residue in prolipoproteins . This post-translational modification is the first step in bacterial lipoprotein maturation, enabling membrane anchoring and subsequent processing by signal peptidase II (Lsp) . Key findings include:

  • Mechanism: Lgt transfers the diacylglyceryl moiety directly from PG, producing glycerolphosphate as a byproduct .

  • Essentiality: Lgt is indispensable for bacterial growth; lgt depletion in Escherichia coli results in cell death .

  • Conservation: Lgt enzymes share conserved motifs across Gram-negative and Gram-positive bacteria, including Salmonella, Staphylococcus aureus, and Haemophilus influenzae .

Mutational Analysis

  • Gly104: Substitution to serine in E. coli Lgt reduces enzymatic activity and causes temperature sensitivity .

  • Active-Site Residues: Y26, N146, and G154 are essential for catalysis; R143, E151, R239, and E243 contribute to substrate binding .

Role in Pathogenesis

  • Lgt is linked to virulence in Salmonella and other pathogens. Deletion attenuates infectivity in murine models, while overexpression enhances survival in hostile host environments .

  • In S. arizonae, Lgt-modified lipoproteins may contribute to septicemia and mortality in poultry, as observed in experimental infections .

Comparative Analysis Across Species

SpeciesIdentity with S. arizonae LgtFunctional Overlap
E. coli76%Complements S. arizonae Lgt activity
S. aureus24%Restores Lgt function in E. coli mutants

Future Directions

  • Structural Studies: Cryo-EM or crystallography could elucidate substrate-binding pockets.

  • Inhibitor Screens: High-throughput assays targeting conserved residues (e.g., GGLIG motif) may yield therapeutic leads .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
lgt; SARI_04658; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNLPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFAKRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELVLEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of prolipoprotein diacylglyceryl transferase (Lgt) in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) functions as an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins . Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins . This modification is crucial for bacterial survival as it ensures proper membrane anchoring of lipoproteins that maintain cell envelope architecture, stabilize outer membrane proteins, and facilitate nutrient uptake and transport .

The essential nature of Lgt is evidenced by studies showing that deletion of the lgt gene is lethal to most Gram-negative bacteria . Research with Streptococcus mutans has demonstrated that Lgt-deficient mutants exhibit mislocalization of surface lipoproteins to the culture supernatant and significant growth reduction in specific media conditions . These findings highlight Lgt's critical role in maintaining proper cellular function across bacterial species.

What experimental approaches can identify substrate specificity of Salmonella arizonae Lgt?

Determining the substrate specificity of Salmonella arizonae Lgt requires multi-faceted experimental approaches:

  • Bioinformatic analysis of potential substrates: Identify putative lipoproteins in the Salmonella arizonae genome by searching for the characteristic lipobox motif (typically [L/V/I]-[A/S/T]-[G/A]-C) at the N-terminus of predicted proteins.

  • In vitro lipidation assays: Develop assays using:

    • Synthetic peptides containing the lipobox sequence from predicted Salmonella arizonae lipoproteins

    • Radiolabeled phosphatidylglycerol to track diacylglyceryl transfer

    • Mass spectrometry to confirm lipid modification by detecting mass shifts

  • Competition assays: Measure relative processing efficiency of different substrate peptides to establish preference hierarchies.

  • Mutagenesis studies: Introduce point mutations in the lipobox sequence to identify critical determinants of recognition.

  • GFP-based reporter systems: Similar to those used with E. coli Lgt, these can correlate substrate processing with fluorescent readouts .

  • Complementation approaches: Test the ability of wild-type and mutant Lgt variants to restore proper lipoprotein localization in Lgt-deficient strains, as demonstrated with Streptococcus mutans .

A comprehensive substrate specificity profile would require comparison of processing efficiency across multiple candidate lipoproteins, potentially revealing whether Salmonella arizonae Lgt exhibits preferences that might contribute to its adaptation to specific ecological niches.

What structural features enable Lgt to catalyze diacylglyceryl transfer?

While the specific structure of Salmonella arizonae Lgt has not been reported in the search results, valuable insights can be gained from high-resolution crystal structures of E. coli Lgt . These structures reveal critical architectural features likely conserved in Salmonella arizonae Lgt:

  • Binding site architecture: E. coli Lgt contains two distinct binding sites - one for phosphatidylglycerol (lipid donor) and another that accommodates the inhibitor palmitic acid (providing insights into substrate binding) .

  • Catalytic residues: Complementation studies identified Arg143 and Arg239 as essential for diacylglyceryl transfer activity . These residues likely participate in substrate binding and/or catalysis through charge interactions with phospholipid headgroups.

  • Membrane integration: The multiple hydrophobic segments in the Salmonella arizonae Lgt sequence suggest transmembrane domains that position the enzyme within the membrane bilayer, enabling access to membrane-embedded phosphatidylglycerol substrates.

  • Lateral access mechanism: The E. coli Lgt structure supports a mechanism whereby substrates and products enter and exit the enzyme laterally relative to the lipid bilayer . This arrangement facilitates the processing of membrane-associated prolipoproteins without requiring their complete extraction from the membrane environment.

The catalytic mechanism likely involves precise positioning of the phosphatidylglycerol donor and prolipoprotein acceptor to facilitate nucleophilic attack by the cysteine thiol on the phosphatidylglycerol ester bond, resulting in diacylglyceryl transfer.

How do mutations in conserved residues affect Lgt activity and substrate recognition?

Studies of E. coli Lgt provide a framework for understanding how mutations in conserved residues affect enzyme function. Complementation experiments with various Lgt mutants revealed several critical findings:

  • Essential arginine residues: Mutations in Arg143 and Arg239 abolished diacylglyceryl transfer activity, indicating their essential role in catalysis . These positively charged residues likely interact with negatively charged phospholipid headgroups to facilitate substrate binding and positioning.

  • Binding site integrity: Mutations that disrupt the architecture of either binding site (phosphatidylglycerol or prolipoprotein) would be expected to reduce catalytic efficiency through impaired substrate recognition or binding.

  • Membrane association: Alterations in transmembrane domains could affect proper insertion into the membrane or disrupt the lateral access mechanism for substrates and products.

The effects of specific mutations can be assessed through multiple approaches:

  • In vivo complementation: Testing mutant Lgt variants for their ability to restore growth and proper lipoprotein localization in Lgt-deficient strains

  • In vitro activity assays: Comparing wild-type and mutant enzyme kinetics using purified components

  • Structural analysis: Determining how mutations alter protein conformation using techniques like X-ray crystallography, cryo-EM, or molecular dynamics simulations

Creating a comprehensive mutational map of Salmonella arizonae Lgt would provide valuable insights into structure-function relationships and potentially identify species-specific features.

What biophysical techniques are most effective for studying Lgt membrane integration?

Investigating the membrane integration of Salmonella arizonae Lgt requires specialized biophysical techniques suitable for membrane proteins:

TechniqueApplicationAdvantagesLimitations
Cryo-electron microscopyHigh-resolution structural determination in lipid environmentsCan visualize protein in native-like membrane setting; doesn't require crystallizationRequires specialized equipment; challenging for smaller membrane proteins
X-ray crystallographyAtomic resolution structure determinationHighest resolution potential; successful for E. coli Lgt Difficult crystallization; may require detergents that alter native state
Hydrogen-deuterium exchange MSMapping solvent-accessible regionsCan identify membrane-embedded segments; works with limited materialIndirect measurement of structure; requires careful controls
Molecular dynamics simulationsDynamic membrane protein behaviorPredicts lipid interactions; simulates conformational changesComputational predictions require experimental validation
Site-directed spin labeling EPRMeasuring distances between protein regionsWorks in membrane environment; detects dynamic changesRequires introduction of spin labels that may perturb function
Fluorescence spectroscopyMonitoring conformational changesCan be performed in real-time; compatible with liposomesLimited structural resolution; requires fluorescent labeling

The most effective approach would combine multiple techniques to overcome the limitations of any single method. For instance, structural data from crystallography or cryo-EM could be complemented by dynamics information from spectroscopic measurements and computational modeling to develop a comprehensive understanding of how Salmonella arizonae Lgt integrates into and functions within the membrane environment.

What expression systems yield functional recombinant Salmonella arizonae Lgt?

Producing functional recombinant Salmonella arizonae Lgt requires careful consideration of expression systems that accommodate its integral membrane nature. While the search results don't specify expression systems for this specific protein, available commercial recombinant products indicate successful production is possible. Researchers should consider these systems:

  • E. coli-based systems:

    • C41(DE3)/C43(DE3) strains: Engineered specifically for toxic membrane protein expression

    • BL21(DE3) pLysS: Provides tight expression control to minimize toxicity

    • Tuner(DE3): Allows for precise regulation of expression levels via IPTG titration

    • Fusion partners: MBP, SUMO, or Mistic fusions can enhance membrane protein solubility and folding

  • Alternative host systems:

    • Salmonella expression: Homologous expression may provide native membrane environment

    • Cell-free systems: Allow addition of detergents/lipids during synthesis to facilitate proper folding

  • Expression conditions optimization:

    • Temperature (typically lower temperatures of 16-25°C favor proper folding)

    • Inducer concentration (minimal induction often preferred)

    • Media composition (supplemented with glycerol to stabilize membranes)

    • Duration (extended expression times at lower temperatures)

For successful expression, vector design should include appropriate purification tags (His-tag, FLAG-tag) positioned to avoid interference with membrane insertion. The specific tag type should be determined during the production process to optimize yield and activity . Codon optimization for the expression host and careful selection of signal sequences may further improve expression levels.

What are the critical parameters for purifying active Lgt enzyme?

Purification of active Salmonella arizonae Lgt requires careful attention to preserve its native structure and function. Based on available information about the commercial protein and general membrane protein purification principles, critical parameters include:

  • Membrane extraction:

    • Detergent selection: Critical for maintaining native structure and activity

    • Optimal detergents: Typically mild non-ionic (DDM, LMNG) or zwitterionic (CHAPS) detergents

    • Detergent concentration: Sufficient for complete solubilization without denaturation

  • Chromatography considerations:

    • Affinity purification: His-tag-based IMAC as initial capture step

    • Buffer composition: Tris-based buffers with appropriate pH (typically 7.5-8.0)

    • Salt concentration: Moderate levels (150-300 mM) to maintain stability

    • Stabilizing additives: 50% glycerol for storage as used in commercial preparations

  • Storage and stability:

    • Temperature: Store at -20°C, with extended storage at -20°C or -80°C

    • Working conditions: Maintain aliquots at 4°C for up to one week

    • Freeze-thaw cycles: Avoid repeated freezing and thawing

    • Stabilizing agents: 50% glycerol and potentially phospholipid additives

  • Quality control metrics:

    • Purity assessment: SDS-PAGE, size-exclusion chromatography

    • Activity assays: Functional assays measuring diacylglyceryl transfer

    • Structural integrity: Circular dichroism to confirm secondary structure

The purification strategy should be tailored to the specific downstream applications, with more stringent purification required for structural studies compared to basic activity assays. The successful crystallization of E. coli Lgt provides precedent that properly purified Lgt can maintain its structural integrity and function.

What assay systems can quantitatively measure Lgt enzymatic activity?

Developing quantitative assays for Salmonella arizonae Lgt activity requires sensitive detection methods that can monitor the transfer of diacylglyceryl groups from phosphatidylglycerol to prolipoprotein substrates. While specific assays for Salmonella arizonae Lgt are not detailed in the search results, several approaches can be adapted:

  • Radiolabeled substrate assays:

    • Use 14C or 3H-labeled phosphatidylglycerol

    • Measure transfer to acceptor peptides containing lipobox motifs

    • Quantify via scintillation counting after separation of reaction components

  • Fluorescence-based assays:

    • FRET-based detection using appropriately labeled substrate and acceptor

    • Environmental-sensitive fluorophores that change properties upon lipidation

    • GFP-based reporter systems similar to those used with E. coli Lgt

  • Mass spectrometry approaches:

    • LC-MS/MS to detect mass shifts in peptide substrates

    • MALDI-TOF for high-throughput screening

    • Quantitative analysis using internal standards

  • Coupled enzyme assays:

    • Link Lgt activity to secondary reactions with colorimetric or fluorescent outputs

    • Monitor phosphatidylglycerol consumption or diacylglycerol production

  • In vivo reporter systems:

    • Complement lgt-deficient strains and measure restoration of lipoprotein function

    • Biosensor strains expressing fluorescent proteins dependent on Lgt activity

For quantitative kinetic analysis, assay conditions should be optimized for:

  • pH and temperature optima

  • Detergent type and concentration

  • Divalent cation requirements

  • Linear range of detection

  • Substrate saturation conditions

Validation should include controls using known Lgt inhibitors or catalytically inactive mutants (e.g., Arg143 or Arg239 substitutions based on E. coli Lgt studies ) to confirm assay specificity.

How does Lgt contribute to Salmonella arizonae virulence mechanisms?

While the search results don't directly link Salmonella arizonae Lgt to specific virulence mechanisms, its fundamental role in lipoprotein processing suggests significant contributions to pathogenesis through multiple pathways:

  • Lipoprotein-mediated virulence: Lgt processes lipoproteins that may function as:

    • Adhesins for attachment to host tissues

    • Immune modulators that interact with host pattern recognition receptors

    • Transporters for acquiring essential nutrients during infection

    • Structural components maintaining cell envelope integrity under host stress conditions

  • Environmental adaptation: Salmonella enterica subsp. arizonae is primarily found in reptiles, particularly snakes , suggesting Lgt processes lipoproteins that facilitate adaptation to this ecological niche. When infecting humans, particularly young infants or immunocompromised individuals , these adaptations may contribute to disease.

  • Immune evasion: Properly processed lipoproteins may help evade host immune responses, potentially explaining why Salmonella arizonae infections disproportionately affect individuals with compromised immunity .

  • Stress resistance: Lgt-processed lipoproteins likely contribute to bacterial survival under host-imposed stresses, including oxidative stress, antimicrobial peptides, and nutrient limitation.

The clinical presentations of Salmonella arizonae infections—including gastroenteritis, bacteremia, peritonitis, pleuritis, osteomyelitis, and meningitis —suggest that Lgt-processed lipoproteins may contribute to tissue tropism and invasive capabilities. The fatal outcome reported in a 3-month-old child with microcephaly underscores the potentially severe consequences of Salmonella arizonae virulence mechanisms in vulnerable populations.

What research approaches can identify Lgt as a potential antimicrobial target?

Evaluating Salmonella arizonae Lgt as an antimicrobial target requires multiple complementary research approaches:

  • Target validation studies:

    • Essentiality assessment: Determine if lgt is essential in Salmonella arizonae as it is in most Gram-negative bacteria

    • Conditional knockdown systems: Evaluate phenotypic consequences of reduced Lgt expression

    • Complementation studies: Assess whether heterologous Lgt proteins can rescue function, informing target specificity

  • Structure-based drug design:

    • Leverage E. coli Lgt crystal structures to model Salmonella arizonae Lgt

    • Identify druggable pockets, particularly around catalytic residues (Arg143, Arg239)

    • Virtual screening of compound libraries against these sites

  • High-throughput screening approaches:

    • Develop miniaturized Lgt activity assays suitable for compound library screening

    • Screen for compounds that inhibit enzyme function without general membrane disruption

    • Counter-screen against mammalian cell lines to identify selective inhibitors

  • Medicinal chemistry optimization:

    • Establish structure-activity relationships of lead compounds

    • Optimize for potency, selectivity, and drug-like properties

    • Evaluate resistance potential through serial passage experiments

  • In vivo efficacy studies:

    • Assess efficacy in animal models of Salmonella arizonae infection

    • Determine pharmacokinetics and tissue distribution

    • Evaluate safety and toxicity profiles

The absence of the lipoprotein biosynthesis pathway in humans presents an advantage for antimicrobial development, potentially allowing selective targeting without direct human protein cross-reactivity. The structural insights from E. coli Lgt , particularly regarding critical residues and binding sites, provide valuable starting points for inhibitor design.

How do Lgt-processed lipoproteins interact with host immune systems?

The interaction between Lgt-processed lipoproteins from Salmonella arizonae and host immune systems is complex and multifaceted, though not directly detailed in the search results. Based on general principles of bacterial lipoprotein immunobiology, several important aspects can be inferred:

  • Pattern recognition receptor activation:

    • Bacterial lipoproteins are recognized by Toll-like receptor 2 (TLR2), often in heterodimers with TLR1 or TLR6

    • The diacylglyceryl modification introduced by Lgt is critical for this recognition

    • TLR2 activation triggers pro-inflammatory cytokine production and immune cell recruitment

  • Age-dependent immune responses:

    • Salmonella arizonae infections disproportionately affect young infants , suggesting age-dependent differences in immune responses to Lgt-processed lipoproteins

    • Immature immune systems may have reduced capacity to recognize and respond to these pathogen-associated molecular patterns

  • Immunomodulatory effects:

    • Some bacterial lipoproteins can actively suppress immune responses

    • Lgt-processed lipoproteins might contribute to the ability of Salmonella arizonae to establish infection in immunocompromised hosts

  • Blood-brain barrier interactions:

    • Salmonella arizonae can cause meningitis , suggesting Lgt-processed lipoproteins may interact with the blood-brain barrier

    • This interaction may be particularly significant in young infants with underdeveloped blood-brain barriers or in patients with microcephaly

  • Species-specific adaptations:

    • The primary association of Salmonella arizonae with reptiles suggests its lipoproteins may be adapted to evade reptilian immune systems

    • These adaptations might incidentally contribute to virulence in human hosts

Understanding these interactions could provide insights into the pathogenesis of Salmonella arizonae infections and potentially inform therapeutic approaches targeting either the bacteria or the host immune response.

How can molecular dynamics simulations enhance understanding of Lgt catalytic mechanisms?

Molecular dynamics (MD) simulations offer powerful approaches to investigate the catalytic mechanism of Salmonella arizonae Lgt beyond static structural information:

  • Membrane integration studies:

    • Simulate Lgt insertion into lipid bilayers of varying compositions

    • Examine protein-lipid interactions at the molecular level

    • Identify stable binding sites for phospholipids within the protein structure

  • Substrate binding dynamics:

    • Model interactions between Lgt and phosphatidylglycerol in the membrane environment

    • Simulate prolipoprotein substrate binding and orientation

    • Identify transient interaction sites not visible in crystal structures

  • Catalytic mechanism exploration:

    • Investigate conformational changes during substrate binding and product release

    • Model the chemical reaction using QM/MM methods

    • Examine the roles of critical residues (e.g., Arg143, Arg239 based on E. coli Lgt )

  • Water and ion dynamics:

    • Track water molecule movements within the catalytic site

    • Examine potential roles of water in catalysis

    • Identify ion binding sites that may stabilize transition states

  • Lateral diffusion mechanisms:

    • Simulate how substrates and products enter and exit laterally relative to the lipid bilayer

    • Identify gating mechanisms controlling access to catalytic sites

    • Examine factors affecting the efficiency of this process

Implementation would require:

  • Building on existing E. coli Lgt crystal structure data

  • Homology modeling of Salmonella arizonae Lgt

  • Appropriate force field selection for membrane-protein-substrate systems

  • Sufficient simulation timescales to capture relevant dynamics

  • Validation through experimental approaches like site-directed mutagenesis

The insights gained could inform the design of more efficient enzyme variants for biotechnological applications or guide the development of specific inhibitors as potential antimicrobials.

What synthetic biology applications could utilize engineered Lgt variants?

Engineered Salmonella arizonae Lgt variants offer diverse synthetic biology applications that leverage the enzyme's ability to attach lipid anchors to proteins:

  • Protein display technologies:

    • Surface anchoring of therapeutic proteins on bacterial or synthetic membrane systems

    • Development of whole-cell biosensors with membrane-displayed recognition elements

    • Creation of bacterial vaccine vectors displaying antigenic determinants

  • Controlled protein localization:

    • Programmable membrane targeting of fusion proteins

    • Creation of spatially organized multi-enzyme complexes in synthetic membranes

    • Compartmentalization of synthetic pathways in artificial cells

  • Enzyme immobilization platforms:

    • Lipid anchoring of industrial enzymes to enhance stability and reusability

    • Organization of sequential enzymes in membrane scaffolds for improved reaction efficiency

    • Development of membrane-bound biocatalysts for environmental applications

  • Drug delivery systems:

    • Creation of lipid-modified targeting proteins for liposome delivery

    • Development of bacteria-based delivery systems with modified surface properties

    • Engineering membrane-anchored therapeutic protein release mechanisms

  • Synthetic membrane biology:

    • Building functional reconstituted systems with defined lipoprotein components

    • Creating minimal membrane systems with engineered properties

    • Developing artificial cells with lipid-anchored functional proteins

Engineering approaches might include:

  • Altering substrate specificity through active site modifications

  • Modifying membrane association properties

  • Creating inducible or switchable variants

  • Developing orthogonal Lgt-substrate pairs for selective modification

The availability of recombinant Salmonella arizonae Lgt provides a starting point for such engineering efforts, though significant protein engineering would be required to adapt the enzyme for these diverse applications.

How does bacterial species variation in Lgt structure reflect evolutionary adaptation?

Comparative analysis of Lgt across bacterial species, including Salmonella arizonae, reveals evolutionary adaptations to diverse ecological niches:

  • Structural conservation and divergence:

    • Core catalytic domains show high conservation reflecting essential function

    • Peripheral regions exhibit greater variability, potentially adapting to:

      • Different membrane compositions across bacterial habitats

      • Variations in prolipoprotein substrate pools

      • Species-specific regulatory mechanisms

  • Niche-specific adaptations:

    • Salmonella arizonae, primarily found in reptiles , likely evolved Lgt variants optimized for:

      • Reptilian body temperatures

      • Reptile-specific gut conditions

      • Processing lipoproteins involved in reptile colonization

  • Pathogen-specific features:

    • Human pathogens may evolve Lgt variants that process lipoproteins involved in:

      • Immune evasion mechanisms

      • Host cell invasion strategies

      • Survival under host-imposed stresses

  • Substrate recognition evolution:

    • Variations in lipobox sequence preferences between species

    • Adaptations to process specialized lipoproteins unique to ecological niches

    • Co-evolution with species-specific lipoprotein repertoires

  • Biochemical property adaptation:

    • Temperature optima aligned with host environments

    • pH tolerance reflecting natural habitat conditions

    • Membrane fluidity adaptations for different thermal environments

Bacterial GroupTypical HabitatPotential Lgt Adaptations
Salmonella arizonaeReptile gutOptimized for lower temperatures; processes reptile-colonization lipoproteins
E. coliMammalian gutAdapted to 37°C; processes mammalian-interaction lipoproteins
Streptococcus mutansOral cavityAcid tolerance; processes adhesion and biofilm lipoproteins
Environmental bacteriaSoil/waterGreater temperature range tolerance; diverse substrate recognition

Evolutionary analysis of Lgt across species provides insights into bacterial adaptation strategies and might identify species-specific features that could be targeted for antimicrobial development or biotechnological applications.

What are the most promising future research directions for Salmonella arizonae Lgt?

The study of Salmonella arizonae prolipoprotein diacylglyceryl transferase (Lgt) presents several promising research directions that build upon current knowledge while addressing significant gaps:

  • Structural characterization: Determining the three-dimensional structure of Salmonella arizonae Lgt would provide species-specific insights beyond what can be inferred from the E. coli homolog . This would facilitate structure-based drug design and mechanistic understanding of catalysis.

  • Lipoproteomic profiling: Comprehensive identification of Lgt-processed lipoproteins in Salmonella arizonae would provide insights into the bacterium's adaptation to reptilian hosts and its occasional pathogenicity in humans, particularly infants and immunocompromised individuals .

  • Host-pathogen interaction studies: Investigating how Lgt-processed lipoproteins interact with host immune systems could explain the age-dependent susceptibility to Salmonella arizonae infections and the range of clinical presentations from gastroenteritis to meningitis .

  • Antimicrobial development: The essentiality of Lgt in most Gram-negative bacteria and the availability of structural information make it a promising target for novel antimicrobials, particularly important for treating infections caused by multi-drug resistant Salmonella strains.

  • Synthetic biology applications: Engineered Lgt variants could enable novel biotechnological applications, from membrane protein display systems to targeted drug delivery platforms.

These research directions would benefit from interdisciplinary approaches combining structural biology, microbiology, immunology, medicinal chemistry, and synthetic biology to fully explore the fundamental and applied aspects of this essential bacterial enzyme.

How might emerging technologies enhance Lgt research and applications?

Emerging technologies offer transformative potential for advancing Salmonella arizonae Lgt research and applications:

  • Cryo-electron microscopy advancements:

    • Enabling atomic-resolution structures of Lgt in native-like membrane environments

    • Visualizing dynamic conformational changes during catalysis

    • Capturing Lgt-substrate complexes in different functional states

  • AI-driven protein structure prediction:

    • Generating accurate models of Salmonella arizonae Lgt based on sequence information

    • Predicting effects of mutations on structure and function

    • Designing optimized Lgt variants with desired properties

  • Genome editing technologies:

    • CRISPR-Cas systems for precise genetic manipulation of Salmonella arizonae

    • Creating conditional knockdown strains to study Lgt essentiality

    • Engineering bacterial systems with modified lipoprotein processing pathways

  • Single-molecule techniques:

    • Tracking individual Lgt molecules in membranes to understand dynamics

    • Measuring forces and energetics of substrate binding and product release

    • Observing rare or transient states in the catalytic cycle

  • Microfluidic and organ-on-chip systems:

    • Studying Lgt function in controlled microenvironments

    • Investigating host-pathogen interactions in physiologically relevant conditions

    • High-throughput screening of Lgt inhibitors

  • Synthetic membrane technologies:

    • Reconstituting Lgt in defined membrane systems

    • Creating artificial cells with engineered lipoprotein processing

    • Developing biohybrid systems combining biological and synthetic components

These technologies, when integrated with traditional approaches, promise to accelerate understanding of Lgt function and facilitate development of applications ranging from novel antimicrobials to synthetic biology platforms. The interdisciplinary nature of these approaches emphasizes the need for collaborative research spanning multiple scientific domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.