Recombinant Salmonella arizonae Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; SARI_02303; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella arizonae Protein CrcB homolog and what is its genetic context?

Protein CrcB homolog (crcB) from Salmonella arizonae is a membrane protein encoded by the crcB gene. It is found in Salmonella enterica subspecies arizonae (strain ATCC BAA-731/CDC346-86/RSK2980) and is characterized by the UniProt accession number A9MKE7. The gene is identified by the ordered locus name SARI_02303 and encodes a 127-amino acid full-length protein .

Genomically, S. arizonae occupies an evolutionary position between Salmonella subgroup I (human pathogens) and Salmonella subgroup V (S. bongori; usually non-pathogenic to humans). The complete genome of S. arizonae strain RKS2983 consists of 4,574,836 bp containing 4,203 protein-coding genes, 82 tRNA genes, and 7 rRNA operons . This evolutionary position makes S. arizonae an ideal model organism for studying bacterial evolution from non-human to human pathogens .

How does crcB in S. arizonae compare to homologous proteins in other species?

The crcB protein shows homology to similar proteins in other bacterial species, particularly to the CrcB homolog in Aeromonas salmonicida. Comparative analysis reveals both sequence similarities and differences that reflect evolutionary divergence:

SpeciesUniProt IDAmino Acid LengthNotable Sequence Features
Salmonella arizonaeA9MKE7127mLQLLLAVFIGGGTGSVARWmLSMR...
Aeromonas salmonicidaA4STL2125MQTWLFVAAGGAIGACLRFGISEL...

While both proteins share functional homology as CrcB homologs, their sequence divergence reflects adaptation to their respective bacterial environments. Such comparative studies are valuable for understanding protein evolution and functional conservation across bacterial species .

What are the optimal storage conditions for recombinant crcB protein?

For optimal stability and activity, the recombinant crcB protein should be stored in a Tris-based buffer with 50% glycerol at -20°C. For extended storage periods, maintaining the protein at -80°C is recommended to prevent degradation .

Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. This precaution is particularly important for membrane proteins like crcB, which are often less stable than soluble proteins .

For experimental procedures spanning multiple days, preparing fresh working aliquots from the main stock is recommended rather than repeatedly freezing and thawing the same aliquot. This approach helps maintain protein integrity and experimental reproducibility.

How can I design experiments to study crcB protein function in bacterial systems?

When designing experiments to investigate crcB protein function:

  • Expression System Selection: Consider using regulated expression systems such as the araC PBAD promoter-based system, which has been successfully used for controlled expression of various proteins in Salmonella .

  • Mutagenesis Approach: Design site-directed mutagenesis experiments targeting conserved residues to identify functional domains. Similar approaches with other Salmonella proteins like MazF have successfully identified key functional residues such as Arg-73 .

  • Functional Assays: Develop fluorometric assays similar to those used for MazF-SEA to measure protein activity. These assays can utilize modified oligonucleotide probes with fluorescent tags such as 6-carboxyfluorescein (6-FAM) at the 5′ end and quenchers like black hole quencher-1 (BHQ-1) at the 3' end .

  • Protein-Protein Interaction Studies: Implement pull-down assays or bacterial two-hybrid systems to identify potential interaction partners of crcB, which could provide insights into its functional networks.

  • In vivo Functional Studies: Develop knock-out and complementation experiments to assess phenotypic changes associated with crcB disruption or overexpression in Salmonella arizonae.

What purification methods are most effective for recombinant crcB protein?

Purification of membrane proteins like crcB requires specialized approaches:

  • Cell Lysis and Membrane Fraction Isolation: Utilize methods such as sonication or French press for bacterial cell disruption, followed by differential centrifugation to isolate membrane fractions.

  • Detergent Solubilization: Employ mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to solubilize the membrane-bound crcB protein without causing denaturation.

  • Affinity Chromatography: If the recombinant protein contains an affinity tag (which would be determined during the production process as indicated in the product information), use appropriate affinity chromatography such as nickel-NTA for His-tagged proteins or glutathione sepharose for GST-tagged proteins .

  • Size Exclusion Chromatography: Implement size exclusion chromatography as a polishing step to remove aggregates and obtain homogeneous protein preparations.

  • Quality Control: Assess protein purity using SDS-PAGE and Western blotting, and verify structural integrity using circular dichroism or fluorescence spectroscopy.

For membrane proteins like crcB, maintaining the proper detergent concentration throughout purification is critical to prevent protein aggregation while preserving native-like conformation and function.

How can structural prediction tools be applied to understand crcB function?

Advanced structural prediction tools can provide valuable insights into crcB function:

  • AlphaFold2 Prediction: Similar to the approach used for MazF-SEA , AlphaFold2 can be employed to predict the 3D structure of crcB. This approach has become an effective alternative to crystallization for structural analyses of proteins .

  • Structure-Function Analysis: The predicted structure can be aligned with structures of homologous proteins to identify conserved structural elements potentially involved in function.

  • Molecular Dynamics Simulations: These can be used to study the dynamic behavior of the protein within a membrane environment, providing insights into conformational changes relevant to function.

  • Binding Site Prediction: Computational methods can identify potential binding sites for ions, small molecules, or other proteins, generating hypotheses for experimental validation.

  • Evolutionary Conservation Mapping: Mapping sequence conservation onto the predicted structure can highlight functionally important regions that have been preserved throughout evolution.

The success of this approach was demonstrated with MazF-SEA, where structural prediction and comparison with crystal structures of related proteins led to the identification of Arg-73 as a key residue for RNA recognition .

What role might crcB play in Salmonella pathogenicity and host adaptation?

The potential role of crcB in Salmonella pathogenicity can be analyzed in the context of evolutionary adaptation:

  • Evolutionary Position: S. arizonae lies evolutionarily between human pathogenic Salmonella (subgroup I) and typically non-human pathogenic S. bongori (subgroup V), making it valuable for studying the evolution of pathogenicity .

  • Pathogenicity Islands: While specific information about crcB's presence in pathogenicity islands is not provided, the S. arizonae genome contains several Salmonella pathogenicity islands (SPIs) shared with either S. bongori or S. typhimurium/S. typhi, suggesting a transitional role in the evolution of virulence .

  • Host Adaptation: The genome of S. arizonae contains features not reported in subgroup I or V, potentially providing insights into genetic divergence associated with host adaptation from cold- to warm-blooded hosts .

  • Experimental Approaches: To investigate crcB's role in pathogenicity, researchers could implement:

    • Comparative genomics across Salmonella species with varying host ranges

    • Infection models using both cold- and warm-blooded host cells

    • Gene knock-out studies followed by virulence assays

    • Transcriptomic analyses under conditions mimicking host environments

How can crcB be utilized in vaccine development strategies?

The potential application of crcB in vaccine development can be considered within the broader context of Salmonella-based vaccine vectors:

  • Vector Development: Salmonella strains have been engineered as delivery vehicles for vaccines, utilizing features such as regulated delayed in vivo attenuation, regulated delayed in vivo antigen synthesis, and programmed delayed in vivo cell lysis .

  • Genetic Stability: When developing Salmonella vaccine vectors, the stability of introduced genetic constructs is crucial. Research on recombination in Salmonella has shown that mutations in recA and recF genes can reduce both intraplasmid and interplasmid recombination, potentially improving stability of vaccine constructs .

  • Antigen Delivery: Salmonella can effectively deliver antigens in the body through mechanisms like regulated programmed lysis, which releases protective antigens while ensuring biological containment .

  • Research Approaches:

    • Investigate whether crcB could be used as an antigen in Salmonella-based vaccines

    • Explore potential roles of crcB in stabilizing genetic constructs in vaccine vectors

    • Assess whether crcB modulation affects Salmonella's ability to colonize lymphoid tissues, which is important for vaccine efficacy

  • Safety Considerations: The development of such vaccines must address safety concerns, particularly when using human pathogen-derived proteins like those from S. arizonae .

What are common challenges in working with recombinant crcB protein and how can they be addressed?

Working with membrane proteins like crcB presents several challenges:

  • Low Expression Levels:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize expression conditions by testing different host strains, promoters, and induction parameters. Consider using specialized expression hosts designed for membrane proteins.

  • Protein Aggregation:

    • Problem: Improper folding leading to protein aggregation.

    • Solution: Express at lower temperatures (16-20°C), use fusion partners like MBP (maltose-binding protein) that enhance solubility, and optimize detergent selection for solubilization.

  • Protein Degradation:

    • Problem: Susceptibility to proteolytic degradation.

    • Solution: Add protease inhibitors during purification, use protease-deficient expression strains, and optimize buffer conditions to enhance stability.

  • Functional Assay Development:

    • Problem: Challenging to develop assays for membrane proteins with unknown function.

    • Solution: Consider indirect assays such as binding studies with potential ligands, membrane integration assays, or complementation of knockout strains.

  • Structural Characterization:

    • Problem: Difficult to obtain structural information for membrane proteins.

    • Solution: Utilize computational prediction methods like AlphaFold2, consider cryo-EM for larger complexes, or use NMR for smaller membrane proteins or domains.

How can molecular genetic techniques be applied to study crcB function in Salmonella?

Advanced molecular genetic approaches for studying crcB function include:

  • CRISPR-Cas9 Genome Editing:

    • Generate precise mutations or deletions in the crcB gene

    • Create reporter fusions to study expression patterns

    • Implement CRISPRi for conditional knockdown studies

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through sequence alignment or structural prediction

    • Create alanine-scanning libraries to systematically identify functional residues

    • Design mutations based on homology to well-characterized proteins like the MazF-SEA study

  • Fluorescence-Based Techniques:

    • Develop fluorescent protein fusions to study localization and dynamics

    • Implement FRET-based approaches to study protein-protein interactions

    • Use fluorescent substrates for functional assays similar to those developed for MazF-SEA

  • Transcriptomic and Proteomic Analyses:

    • Compare wild-type and crcB-mutant strains to identify affected pathways

    • Implement RNA-seq to study transcriptome-wide effects of crcB mutation

    • Use quantitative proteomics to identify changes in protein expression patterns

  • Comparative Genomics:

    • Analyze crcB conservation and variation across Salmonella species with different host ranges

    • Identify co-evolving genes that may functionally interact with crcB

    • Study synteny of the genomic region containing crcB for evolutionary insights

What approaches can be used to determine the physiological role of crcB in Salmonella arizonae?

To elucidate the physiological role of crcB in Salmonella arizonae:

  • Phenotypic Analysis of crcB Mutants:

    • Generate crcB knockout mutants and characterize growth under various conditions

    • Test resistance to stresses such as oxidative stress, pH, osmotic shock, and antimicrobials

    • Assess virulence-associated phenotypes such as invasion and intracellular survival

  • Transcriptional Regulation Studies:

    • Identify conditions that affect crcB expression

    • Characterize the promoter region and transcriptional regulators

    • Implement reporter fusions to monitor expression under different conditions

  • Protein-Protein Interaction Network:

    • Perform pull-down assays or bacterial two-hybrid screens to identify interaction partners

    • Use crosslinking mass spectrometry to identify transient interactions

    • Validate interactions using co-immunoprecipitation or FRET

  • Comparative Studies with Related Species:

    • Compare function and regulation of crcB across Salmonella subspecies

    • Implement complementation studies in related species

    • Analyze differences in crcB between pathogenic and non-pathogenic Salmonella strains

  • Host-Pathogen Interaction Studies:

    • Assess the role of crcB during infection of host cells

    • Compare behavior of wild-type and crcB mutants during host colonization

    • Determine if crcB affects immune response during infection

The evolutionary position of S. arizonae between human pathogens and non-pathogens makes these studies particularly valuable for understanding how crcB may contribute to the adaptation to different hosts .

How does understanding crcB contribute to broader knowledge of bacterial evolution and pathogenicity?

The study of crcB in Salmonella arizonae provides valuable insights into bacterial evolution and pathogenicity:

  • Evolutionary Transition: S. arizonae occupies a critical position between Salmonella subgroup I (human pathogens) and subgroup V (S. bongori, typically non-pathogenic to humans), making it an ideal model for studying evolutionary transitions in pathogenicity .

  • Genomic Comparisons: Comparative genomic analyses have shown that S. arizonae shares certain pathogenicity islands with either S. bongori or S. typhimurium/S. typhi, suggesting it represents an evolutionary intermediate .

  • Host Adaptation: Understanding how proteins like crcB function in S. arizonae could provide insights into the adaptation of Salmonella from cold-blooded to warm-blooded hosts, a key event in the evolution of human pathogens .

  • Functional Diversification: Studies of homologous proteins across bacterial species can reveal how functional diversification occurs during evolution, as demonstrated by the analysis of RNA recognition by MazF in S. arizonae .

  • Research Framework: Integrating studies of crcB with broader evolutionary analyses can contribute to a comprehensive framework for understanding pathogen evolution, potentially informing strategies for predicting and addressing emerging pathogens.

What emerging technologies might enhance future research on crcB and related proteins?

Several emerging technologies hold promise for advancing research on crcB:

  • Cryo-Electron Microscopy (Cryo-EM): The revolution in cryo-EM technology enables structural determination of membrane proteins without crystallization, potentially allowing visualization of crcB in its native membrane environment.

  • Single-Cell Technologies: Advanced single-cell sequencing and imaging techniques can reveal cell-to-cell variation in crcB expression and function during infection or stress responses.

  • Nanobody Technology: The development of nanobodies (single-domain antibody fragments) specific to crcB could enable targeted studies of localization, dynamics, and interaction partners.

  • Advanced Computational Approaches:

    • Improved protein structure prediction using deep learning approaches like AlphaFold2

    • Molecular dynamics simulations in complex membrane environments

    • Systems biology modeling of crcB in cellular networks

  • Genome-Wide CRISPR Screens: Implementation of CRISPR-based functional genomics to identify genes that interact genetically with crcB, revealing functional networks and potential compensatory mechanisms.

  • Synthetic Biology Approaches: Engineering of minimal Salmonella systems to study the core functions of proteins like crcB, potentially revealing fundamental principles governing bacterial physiology and pathogenicity.

How can findings about crcB be integrated with other research areas for innovative applications?

Integration of crcB research with other fields can lead to novel applications:

  • Vaccine Development: Insights from crcB structure and function can inform the design of improved Salmonella-based vaccine vectors, building on existing work that uses Salmonella for vaccine delivery .

  • Antimicrobial Development: Understanding the physiological role of crcB might reveal new targets for antimicrobial therapies, particularly if crcB is involved in processes essential for pathogen survival or virulence.

  • Synthetic Biology Tools: Knowledge about protein engineering derived from studies like those on MazF-SEA can be applied to crcB, potentially developing tools for biotechnology applications such as programmable bacterial devices.

  • Diagnostic Development: If crcB shows specific patterns of expression during infection, this knowledge could be leveraged to develop diagnostic tools for detecting Salmonella infections.

  • Evolutionary Medicine: Integration of findings about crcB with evolutionary analyses can contribute to the field of evolutionary medicine, which applies evolutionary principles to understand health and disease.

  • One Health Approaches: Considering that Salmonella infections span human, animal, and environmental spheres, crcB research can contribute to "One Health" initiatives that address health challenges at the intersection of these domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.