Recombinant Salmonella arizonae Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Biochemical and Production Characteristics

Recombinant GlpG is produced in two primary expression systems, as detailed below:

PropertyMammalian Cell-Derived (CSB-MP434778STE1)E. coli-Derived (CSB-EP434778STE1)
SourceMammalian cellsE. coli
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage (Liquid)6 months at -20°C/-80°C6 months at -20°C/-80°C
Storage (Lyophilized)12 months at -20°C/-80°C12 months at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water with 5–50% glycerolSame as mammalian variant
TagDetermined during manufacturingDetermined during manufacturing

Key Notes:

  • Gene Name: glpG (UniProt ID: A9MMA7) .

  • Protein Length: Partial sequence (specific residues not disclosed).

  • Host Systems: Compatible with mammalian, E. coli, yeast, or baculovirus systems .

Catalytic Mechanism

GlpG employs a Ser-His dyad for proteolytic activity, cleaving substrates at hydrophilic regions near transmembrane domains. Studies using inhibitors like 3,4-dichloroisocoumarin (DCI) confirm its serine protease mechanism . Structural analyses reveal:

  • A six-transmembrane helical topology with a water-accessible catalytic cavity .

  • Dynamic gating by transmembrane helix TM5, which undergoes conformational shifts for substrate access .

Substrate Recognition

GlpG preferentially cleaves substrates with:

  • Transmembrane domains containing hydrophilic motifs.

  • Juxtamembrane regions rich in residues like Ser and Asp .

Bacterial Fitness and Pathogenesis

  • Gut Colonization: Salmonella arizonae GlpG enhances bacterial persistence in the mammalian gut by regulating fatty acid β-oxidation and glycerol degradation pathways .

  • Virulence: In Escherichia coli, GlpG disruption reduces survival in murine models, linking it to extraintestinal pathogenic E. coli (ExPEC) virulence .

Research Applications

  • Membrane Protein Studies: Used to investigate intramembrane proteolysis mechanisms .

  • Drug Target Screening: Structural dynamics inform inhibitor design targeting rhomboid proteases .

Comparative Analysis of GlpG Homologs

Multiple bacterial species express GlpG homologs with conserved functions:

SpeciesGene NameHost SystemPurity
Salmonella enteritidis PT4glpGE. coli≥85%
Escherichia coli O9:H4EcHS_A3621E. coli≥85%
Shigella boydii serotype 18SbBS512_E3806E. coli≥85%

Source: MyBioSource product listings .

Stability and Handling Recommendations

  • Freeze-Thaw Cycles: Avoid repeated cycles; store working aliquots at 4°C for ≤1 week .

  • Lyophilization: Reconstitute with glycerol (50% final concentration recommended) for long-term stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for your order.
Synonyms
glpG; SARI_04097; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRAELARFMENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWTVMVACVLVYIAMNLVGDQTVM VWLAWPFDPALKFEFWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WLDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid protease glpG and what is its biological significance?

Rhomboid protease glpG is an intramembrane protease that hydrolyzes substrate peptide bonds within the lipid bilayer. This enzyme belongs to the rhomboid family of proteases and plays critical roles in various biological processes across different species. In bacterial systems such as Salmonella, glpG has been identified as important for survival and colonization in host environments . The bacterial intramembrane protease GlpG serves as one of the primary model systems for structural investigations of the entire rhomboid family due to its relatively simple architecture while maintaining the functional characteristics of this enzyme class .

How does Rhomboid protease glpG structure relate to its function?

The structure of glpG consists of multiple transmembrane domains with a critical catalytic cavity containing water molecules, which has been confirmed through proton-detected experiments . A particularly important structural feature is the presence of a previously unobserved kink in the central part of the gating helix TM5, identified through secondary chemical shift analysis .

The protein exhibits a dynamic hotspot at the N-terminal part of TM5 and the adjacent loop L4, which appears to be crucial for the gating mechanism. Relaxation dispersion experiments suggest that TM5 exists in conformational exchange between open and closed conformations, providing a structural basis for substrate entry and processing . This dynamic behavior is essential for the enzyme to properly identify, capture, and cleave its substrates within the membrane environment.

What expression systems are typically used for recombinant production of Salmonella arizonae Rhomboid protease glpG?

For research applications, Rhomboid protease glpG from Salmonella arizonae is typically expressed in E. coli expression systems using vectors that allow for the addition of affinity tags (commonly His-tags) to facilitate purification . The general methodology follows these steps:

  • Gene synthesis or cloning of the glpG gene (covering amino acids 1-276) from Salmonella arizonae

  • Insertion into appropriate expression vectors with N-terminal or C-terminal His-tags

  • Transformation into competent E. coli cells optimized for protein expression

  • Induction of protein expression (typically with IPTG for T7-based systems)

  • Cell lysis and protein purification using immobilized metal affinity chromatography

  • Buffer optimization to maintain protein stability, often including glycerol and Tris-based buffers

The resulting purified protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage .

How can researchers assess the enzymatic activity of recombinant Rhomboid protease glpG in vitro?

Assessing enzymatic activity of recombinant glpG requires:

  • Substrate selection: Researchers typically use fluorogenic peptide substrates containing sequences recognized by rhomboid proteases. These substrates are designed with fluorophore and quencher pairs that exhibit increased fluorescence upon cleavage.

  • Membrane mimetic environment: Since glpG is an intramembrane protease, activity assays must be performed in environments that mimic the lipid bilayer, such as:

    • Detergent micelles (commonly used: DDM, LDAO)

    • Liposomes composed of defined phospholipids

    • Nanodiscs with controlled lipid composition

  • Reaction conditions optimization:

    ParameterTypical RangeOptimization Notes
    pH6.5-8.0Serine proteases often function optimally at slightly alkaline pH
    Temperature25-37°CDepending on the species of origin
    Divalent ions0-5 mMSome rhomboid proteases show metal ion dependence
    Reaction time1-24 hoursMonitor at multiple timepoints for kinetic analysis
  • Activity detection: Analyze reaction products via:

    • Fluorescence spectroscopy (for fluorogenic substrates)

    • SDS-PAGE and western blotting

    • Mass spectrometry for precise cleavage site identification

  • Controls:

    • Catalytic site mutants (typically S/A or H/A mutations)

    • Heat-inactivated enzyme

    • Protease inhibitor treatments

This methodology provides quantitative data on substrate specificity, kinetic parameters, and the effects of various conditions on enzymatic activity .

What are the most effective methods for studying glpG membrane dynamics in a native-like environment?

To study glpG membrane dynamics in conditions that closely mimic its natural environment, researchers have employed several advanced biophysical techniques:

  • Solid-state NMR spectroscopy: This has proven particularly valuable for studying enzymatically active GlpG in a native-like lipid environment. This approach has revealed:

    • The presence of water molecules in the catalytic cavity

    • Previously unobserved structural features like the kink in TM5

    • Dynamic properties of different protein regions

  • Relaxation dispersion experiments: These experiments have demonstrated that TM5 undergoes conformational exchange between open and closed states, providing insight into the gating mechanism .

  • Molecular dynamics simulations: Computational approaches complement experimental methods by:

    • Providing atomistic details of protein-lipid interactions

    • Simulating substrate gating mechanisms

    • Predicting water molecule distribution within the protein

  • Site-directed spin labeling and EPR spectroscopy: These techniques can track domain movements during substrate binding and processing.

  • Single-molecule FRET: For observing real-time conformational changes during catalytic activity.

The combination of these approaches provides a comprehensive understanding of the dynamic behavior of glpG within the membrane environment, which is essential for deciphering its catalytic mechanism and substrate selectivity .

How does Rhomboid protease glpG contribute to bacterial persistence and pathogenesis?

Research has revealed that glpG plays significant roles in bacterial persistence and pathogenesis through several mechanisms:

  • Intestinal colonization: Disruption of glpG in extraintestinal pathogenic E. coli (ExPEC) significantly reduced bacterial survival in a mouse gut colonization model with unperturbed natural microbiota. This effect was specific to glpG and not observed with the disruption of the downstream gene glpR, indicating a specialized role for glpG in gut colonization .

  • Growth in mucus-rich environments: Mutation of glpG impaired ExPEC growth in mucus and on plates containing oleate (a long-chain fatty acid) as the sole carbon source. This suggests that glpG may be involved in the metabolism of specific carbon sources found in host environments .

  • Polar effects on downstream genes: In vitro experiments showed that disruption of glpG had polar effects on the downstream gene glpR, which encodes a transcriptional repressor of factors involved in glycerol degradation. This connection to metabolic pathways may contribute to the bacterium's ability to utilize alternative carbon sources during infection .

  • Potential substrate processing: While the specific substrates of glpG in pathogenic contexts are still being investigated, it likely processes key proteins involved in bacterial adaptation to host environments or modulation of host responses .

The identification of glpG as a factor promoting bacterial persistence highlights new avenues for understanding and potentially targeting colonization mechanisms of pathogenic bacteria, which could lead to novel therapeutic approaches .

What are the current hypotheses regarding substrate gating mechanisms in Rhomboid protease glpG?

Based on structural and dynamic studies, two primary models for substrate gating in glpG have been proposed:

  • Lateral gating model:

    • Involves movement of TM5 away from the core of the protein

    • Creates a lateral opening in the membrane-embedded portion of the protein

    • Allows substrate entry from within the membrane plane

    • Supported by crystal structures showing different conformations of TM5

    • Consistent with relaxation dispersion experiments showing TM5 conformational exchange

  • Cap displacement model:

    • Focuses on movement of the extracellular cap (loop L5)

    • Suggests that substrate access occurs from the extracellular side

    • The loop L5 region moves to expose the catalytic site

    • May work in conjunction with lateral gating

Recent solid-state NMR studies in native-like lipid environments have revealed a dynamic hotspot at the N-terminal part of TM5 and the adjacent loop L4, supporting their importance in the gating mechanism . The data also indicates that TM5 exists in equilibrium between at least two conformational states, consistent with an opening and closing motion that would allow substrate access.

These findings suggest that a combination of both mechanisms may be involved, with specific contributions depending on the substrate and lipid environment. Understanding these gating mechanisms is crucial for designing inhibitors or modulators of rhomboid protease activity for potential therapeutic applications.

How can researchers address the challenges of structural heterogeneity when studying membrane proteins like glpG?

Studying membrane proteins like glpG presents unique challenges due to structural heterogeneity arising from their dynamic nature and complex lipid interactions. Researchers can address these challenges through:

  • Integrated structural biology approaches:

    • Combine X-ray crystallography for high-resolution static structures

    • Use solid-state NMR for dynamics and conformational distributions

    • Apply cryo-EM for capturing multiple conformational states

    • Implement small-angle X-ray/neutron scattering for solution ensemble information

  • Native-like reconstitution systems:

    Reconstitution SystemAdvantagesLimitations
    NanodiscsDefined size, native bilayer environmentLimited size, potential scaffold interactions
    LiposomesNative bilayer, variable compositionHeterogeneous orientation, limited for some techniques
    Lipid cubic phasesCompatible with crystallizationComplex manipulation, limited lipid compositions
    Cell-derived membrane vesiclesMost native-like environmentComplex composition, difficult to standardize
  • Computational approaches:

    • Molecular dynamics simulations to sample conformational space

    • Enhanced sampling techniques to capture rare conformational transitions

    • Integrative modeling combining experimental restraints from multiple techniques

  • Single-molecule techniques:

    • Avoid ensemble averaging that masks heterogeneity

    • Track individual molecules through conformational transitions

    • Identify rare or transient states important for function

  • Time-resolved methods:

    • Capture structural changes during the catalytic cycle

    • Identify intermediates that may be missed in equilibrium studies

By combining these approaches, researchers can build a more complete picture of the conformational landscape of glpG and relate structural heterogeneity to functional mechanisms .

What is the potential of targeting Rhomboid protease glpG for antimicrobial development?

Targeting Rhomboid protease glpG represents a promising avenue for novel antimicrobial development based on several key findings:

  • Essential role in pathogen survival: Research has demonstrated that glpG promotes bacterial persistence in host environments, particularly in gut colonization models. In studies with ExPEC, disruption of glpG significantly reduced bacterial survival in mouse gut colonization experiments with intact natural microbiota .

  • Specialized function: The reduction in bacterial fitness observed with glpG mutation was not replicated by mutation of the downstream gene glpR, indicating a specialized role for the protease rather than general metabolic effects .

  • Involvement in adaptation to host environments: glpG mutation impaired bacterial growth in mucus and on media containing specific carbon sources like oleate, suggesting its importance in metabolic adaptation during infection .

  • Structural insights enabling inhibitor design: Detailed structural and dynamic studies of glpG, including the identification of:

    • Water molecules in the catalytic cavity

    • Dynamic gating mechanisms

    • Conformational exchange between open and closed states

    These provide molecular targets for rational drug design approaches .

  • Potential for narrow-spectrum antibiotics: The species-specific differences in rhomboid proteases could allow for the development of narrow-spectrum antibiotics that target specific pathogens while preserving beneficial microbiota.

Developing inhibitors of glpG would represent a novel class of antimicrobials with a mechanism distinct from traditional antibiotics, potentially addressing issues of multidrug resistance in pathogens like Salmonella . Challenges include designing compounds that can access the membrane-embedded active site and achieving specificity against bacterial versus human rhomboid proteases.

How does the structure and function of Salmonella arizonae Rhomboid protease glpG compare to rhomboid proteases in other clinically relevant pathogens?

Comparative analysis of rhomboid proteases across clinically relevant pathogens reveals important similarities and differences:

  • Structural conservation:

    • Core catalytic mechanism involving serine and histidine residues is conserved

    • Transmembrane topology with 6-7 membrane-spanning regions is typical

    • Water molecules in the catalytic cavity are a common feature

  • Functional divergence:

    PathogenRhomboid ProteaseKnown/Proposed FunctionsClinical Significance
    Salmonella arizonaeGlpGGut colonization, growth in mucus-rich environmentsFoodborne illness, invasive infections
    Escherichia coliGlpGSimilar to Salmonella, promotes intestinal colonizationUrinary tract infections, sepsis
    Pseudomonas aeruginosaMultiple rhomboidsQuorum sensing, biofilm formationChronic lung infections, wound infections
    Mycobacterium tuberculosisRv0110Cell envelope maintenanceTuberculosis
    Plasmodium falciparumROM1, ROM4Host cell invasion, adhesin processingMalaria
  • Substrate specificity:

    • Significant variation in substrate recognition across species

    • Different patterns of amino acid preferences around cleavage sites

    • Some process conserved substrates while others have species-specific targets

  • Inhibitor sensitivity:

    • Differential sensitivity to known rhomboid inhibitors

    • Species-specific differences in active site architecture

    • Varying accessibility of the catalytic site due to differences in gating mechanisms

  • Genetic context:

    • Variations in operon structure and genetic linkage to metabolic genes

    • Different regulatory mechanisms controlling expression

    • Variable polar effects on downstream genes

These comparative insights are essential for developing targeted antimicrobial strategies and understanding the evolution of rhomboid proteases as virulence factors across different pathogens. The unique features of each rhomboid protease may provide opportunities for pathogen-specific therapeutic interventions.

What are the key unresolved questions regarding Salmonella arizonae Rhomboid protease glpG function?

Despite significant progress in understanding glpG, several critical questions remain unresolved:

  • Substrate identification: "Additional work is needed to identify the relevant substrate(s) of GlpG and to understand its role in gut colonization by ExPEC" . This fundamental gap limits our understanding of the specific molecular mechanisms by which glpG promotes bacterial persistence.

  • Regulatory mechanisms: How expression and activity of glpG are regulated in response to environmental conditions remains poorly characterized. This includes potential post-translational modifications, protein-protein interactions, or environmental sensing mechanisms.

  • Membrane environment influence: While studies have examined glpG in native-like lipid environments , the specific effects of membrane composition (lipid types, cholesterol content, membrane thickness) on enzyme activity and substrate specificity require further investigation.

  • Evolutionary significance: The conservation and divergence patterns of glpG across bacterial species and their relationship to pathogenicity and niche adaptation remain to be fully elucidated.

  • Catalytic mechanism details: Despite structural insights, the precise catalytic mechanism, including the roles of specific water molecules, proton transfer pathways, and transition state stabilization, needs further clarification.

  • Interaction with host factors: Potential interactions between glpG and host factors during infection, including possible processing of host proteins or detection by host immune surveillance, represent unexplored areas.

Addressing these questions will require interdisciplinary approaches combining structural biology, microbial genetics, biochemistry, and infection models to build a comprehensive understanding of this important enzyme in bacterial pathogenesis.

What emerging technologies might advance our understanding of Rhomboid protease glpG structure-function relationships?

Several cutting-edge technologies show promise for advancing our understanding of glpG:

  • Cryo-electron tomography: Enables visualization of membrane proteins in their native cellular context, potentially revealing physiologically relevant conformations and interactions not captured in purified systems.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility with peptide-level resolution, useful for mapping conformational changes during substrate binding and catalysis.

  • Time-resolved structural methods:

    • Time-resolved X-ray crystallography

    • Time-resolved cryo-EM

    • Time-resolved FRET

    These approaches can capture transient intermediate states during the catalytic cycle.

  • In-cell NMR and EPR: Allow for structural and dynamic studies within living cells, providing insights into how cellular environments influence protein behavior.

  • AlphaFold and related AI approaches: Deep learning methods for structure prediction can generate models of rhomboid-substrate complexes and conformational states difficult to capture experimentally.

  • Integrative structural biology platforms: Combining data from multiple experimental methods (X-ray, NMR, cryo-EM, SAXS, crosslinking-MS) with computational modeling to build more complete structural models.

  • Single-cell proteomics: May reveal cell-to-cell variation in glpG expression and activity within bacterial populations during infection.

  • Advanced microscopies:

    TechnologyApplication to glpG Research
    Super-resolution microscopyMapping glpG distribution in bacterial membranes
    Correlative light and electron microscopyLinking glpG localization to cellular ultrastructure
    Atomic force microscopyMeasuring mechanical properties of membranes with glpG
    Lipid-specific imagingExamining co-localization with specific membrane domains

These technologies, especially when used in combination, promise to provide unprecedented insights into the structure-function relationships of glpG in contexts more relevant to its natural operating environment during infection .

How does understanding Rhomboid protease glpG contribute to the broader field of membrane protein enzymology?

Rhomboid protease glpG has emerged as a model system that has made substantial contributions to our understanding of membrane protein enzymology in several key areas:

  • Catalytic mechanisms within membranes: Studies of glpG have revealed how proteolysis can occur within the hydrophobic environment of a lipid bilayer, including the critical role of water molecules in the catalytic cavity and the coordination of catalytic residues in an unusual environment .

  • Protein dynamics in membranes: Research on glpG has highlighted the importance of protein dynamics for function, particularly the conformational exchange of TM5 between open and closed states, demonstrating how dynamic behavior is essential for substrate gating and catalysis .

  • Structural biology methods development: As a model membrane protein, glpG has driven methodological advances in:

    • Membrane protein crystallization

    • Solid-state NMR of membrane proteins

    • Computational approaches for membrane protein modeling

  • Lipid-protein interactions: Studies of glpG have provided insights into how the lipid environment influences membrane protein structure, dynamics, and function, including specific lipid binding sites and the effects of bilayer properties on enzyme activity.

  • Evolution of catalytic mechanisms: Comparative studies across species have illuminated how membrane-embedded enzymes evolve while maintaining catalytic function in diverse organisms and cellular contexts.

These contributions extend beyond rhomboid proteases to inform our understanding of other membrane protein families, including channels, transporters, receptors, and enzymes. The principles derived from glpG research are broadly applicable to addressing challenges in membrane protein biology and developing therapeutic strategies targeting membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.