Recombinant Salmonella arizonae Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Functional Role in Polyamine Homeostasis

MdtI partners with MdtJ to form a heterodimeric efflux pump belonging to the small multidrug resistance (SMR) family. This complex mediates spermidine excretion, preventing toxicity from overaccumulation:

  • Mechanism:

    • Proton-Coupled Transport: MdtJI exports spermidine via a proton motive force-dependent mechanism, reducing intracellular polyamine levels .

    • Key Residues:

      • MdtI: Glu5, Glu19, Asp60, Trp68, and Trp81 are critical for transport activity. Mutation of Glu19 (e.g., E19Q) abolishes proton-coupled transport and furfural tolerance .

    • Spermidine Selectivity: MdtJI preferentially exports spermidine over putrescine, as demonstrated in E. coli models .

Experimental Evidence:

StudyObservationSource
E. coli spermidine toxicity assayMdtJI expression rescues growth inhibition caused by 2 mM spermidine .
Furfural tolerance assayWild-type MdtJI enhances cell viability under furfural stress (3.5-fold increase in colony counts) .
Spermidine excretion assayMdtJI reduces intracellular spermidine content and increases extracellular levels .

A. Polyamine Regulation

MdtI is essential for studying bacterial polyamine metabolism, particularly in:

  • Pathogen Survival: Maintains homeostasis in pathogens like Salmonella arizonae, enabling adaptation to host environments .

  • Toxin Resistance: Overexpression enhances tolerance to polyamine toxicity, relevant for antibiotic resistance studies .

B. Biotechnological Applications

The MdtJI complex has been engineered for:

  • Furfural Detoxification: MdtJI efflux pumps improve E. coli viability in biofuel production by expelling furfural, a lignocellulosic biomass byproduct .

  • Metabolic Engineering: Chromosomal integration of mdtJI in E. coli increases biomass production under furfural stress by ~4.8-fold .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; SARI_01495; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
mdtI
Target Protein Sequence
MQQFEWVHGAWLALAIILEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVVLLLVGMIMIKLA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does the MdtI protein sequence differ between Salmonella species?

    Comparison of MdtI sequences from different Salmonella species reveals subtle but potentially significant variations. For example:

    SpeciesUniProt IDKey Sequence Differences
    S. arizonaeA9MRT8MQQFEWVHGAWLALAIILEIAANVLLKFSD...
    S. typhimuriumQ7CQK0MQQFEWIHGAWLGLAIMLEIAANVLLKFSD...

    Notable differences include the V→I substitution at position 5 and L→G substitution at position 9, which might affect protein folding or spermidine interaction . These variations reflect the evolutionary divergence between Salmonella subspecies and may contribute to functional differences in spermidine export efficiency or substrate specificity .

  • What expression systems are most effective for producing recombinant MdtI?

    E. coli is the predominant expression system for recombinant MdtI production due to high yield and relatively short turnaround times. The typical methodology involves:

    • Cloning the full-length mdtI gene into an expression vector with an N-terminal His-tag

    • Expression in E. coli under appropriate induction conditions

    • Purification using affinity chromatography

    • Storage as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    Alternative expression systems include yeast, insect cells with baculovirus, and mammalian cells, with the latter two providing posttranslational modifications that may be necessary for certain functional studies . The choice depends on research goals, with E. coli being optimal for structural studies and mammalian systems potentially better for functional assays requiring proper folding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.