Recombinant Salmonella arizonae Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Salmonella arizonae MdtJ is a full-length spermidine export protein produced in Escherichia coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
SpeciesSalmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
UniProt IDA9MRT9
Protein Length120 amino acids (residues 1–120)
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol
Sequence (Partial)MFYWILLALAIVAEITGTLSMKWASVGNGNAGYILmLVMITLSYIFLSFAVKKIALGVAY...

Primary and Secondary Structure

The protein contains transmembrane domains critical for its role in spermidine transport. A computed AlphaFold model (AF-A9MZZ3-F1) of a homolog (Salmonella Paratyphi B MdtJ) predicts a helical transmembrane architecture with a global pLDDT score of 89.15, indicating high confidence in the structural prediction . Key residues implicated in spermidine export (e.g., Tyr 4, Trp 5, Glu 15) are conserved across Salmonella species .

Comparative Analysis

MdtJ homologs share sequence similarity with other small multidrug resistance (SMR) family exporters:

OrganismUniProt IDIdentityKey Functional Residues
Salmonella Paratyphi AB5BK9098%Tyr 4, Trp 5, Glu 15
Yersinia pseudotuberculosisB2K33676%Similar helical topology
Sodalis glossinidiusQ2NVC068%Conserved transmembrane motifs

Functional Role in Spermidine Export

MdtJ forms a complex with MdtI to excrete excess spermidine, mitigating intracellular toxicity . Key findings include:

  • Genetic Requirement: Both mdtJ and mdtI are essential for spermidine efflux .

  • Regulation: mdtJI operon expression is upregulated under high spermidine conditions .

  • Mechanism: The MdtJI complex reduces intracellular spermidine levels by 40–60% in E. coli models, enhancing bacterial survival under stress .

Biochemical Studies

  • ELISA: Used to quantify MdtJ expression in bacterial membrane fractions .

  • Drug Resistance Screening: Evaluates MdtJ’s role in multidrug efflux .

Research Gaps and Future Directions

  • In Vivo Function: Limited data exist on MdtJ’s role in Salmonella arizonae pathogenicity.

  • Structural Validation: The AlphaFold model requires experimental verification (e.g., cryo-EM) .

  • Host Interactions: Unclear how MdtJ interacts with host polyamine metabolism during infection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
mdtJ; SARI_01496; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIVAEITGTLSMKWASVGNGNAGYILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITVFSVLLFDEVLSTMKIVGLLTLIVGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the MdtJ protein in Salmonella arizonae?

MdtJ is a spermidine export protein that functions as part of the MdtJI complex to catalyze the excretion of spermidine from bacterial cells at neutral pH. This function is critical for protecting cells against the toxicity associated with spermidine overaccumulation. Research has demonstrated that both MdtJ and MdtI proteins are required for spermidine excretion activity, as neither protein alone can significantly rescue cell viability during exposure to high spermidine concentrations .

How is MdtJ expression regulated in bacterial cells?

Research has shown that MdtJ expression is responsive to spermidine levels in the cell. The level of mdtJI mRNA increases in the presence of spermidine, suggesting a regulatory mechanism that upregulates the spermidine export system when intracellular spermidine concentrations rise. This represents a biological feedback mechanism to maintain polyamine homeostasis within bacterial cells .

What are the recommended protocols for measuring MdtJ-mediated spermidine export activity?

A validated methodology for measuring MdtJ-mediated spermidine export involves:

  • Culture bacterial cells (such as E. coli CAG2242 transformed with either control vector or mdtJI-expressing plasmid) to mid-log phase

  • Harvest cells and wash with buffer containing 0.4% glucose, 62 mM potassium phosphate (pH 7.0), 1.7 mM sodium citrate, 7.6 mM (NH4)2SO4, and 0.41 mM MgSO4

  • Preload cells with [14C]spermidine (1 mM, 37 MBq/mmol) for 90 minutes

  • Wash cells to remove extracellular labeled spermidine

  • Incubate cells at 37°C and collect samples at designated time points

  • Remove cells by centrifugation at 17,000 × g

  • Measure radioactivity in the supernatant to quantify spermidine excretion

This method allows for direct measurement of spermidine export activity mediated by the MdtJI complex .

How can researchers effectively express and purify recombinant MdtJ for functional studies?

For optimal expression and purification of recombinant MdtJ:

  • Clone the mdtJ gene into an expression vector with an appropriate tag (His-tag is commonly used)

  • Transform the construct into an E. coli expression strain optimized for membrane proteins

  • Induce protein expression under controlled conditions (temperature, IPTG concentration)

  • Lyse cells and solubilize membrane fractions using appropriate detergents

  • Purify using affinity chromatography based on the tag

  • Store in Tris-based buffer with 50% glycerol at -20°C/-80°C

  • For working solutions, aliquot and store at 4°C for up to one week

Note: Repeated freeze-thaw cycles should be avoided to maintain protein functionality .

How do specific amino acid residues contribute to MdtJ function in spermidine export?

Research has identified several critical amino acid residues in MdtJ that are directly involved in its spermidine export activity:

ProteinCritical ResiduesFunction
MdtJTyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, Glu 82Directly involved in spermidine export activity
MdtIGlu 5, Glu 19, Asp 60, Trp 68, Trp 81Essential for functional complex formation with MdtJ

Site-directed mutagenesis studies demonstrate that alterations to these residues significantly reduce or abolish spermidine export capability. This suggests these amino acids form part of the substrate recognition or transport channel within the MdtJI complex. For researchers investigating structure-function relationships, these residues represent prime targets for mutagenesis experiments .

What is the relationship between MdtJ and cell viability under high spermidine conditions?

Experimental evidence demonstrates a direct correlation between MdtJ function and cell survival under spermidine stress:

  • In E. coli CAG2242 (spermidine acetyltransferase-deficient strain), exposure to 2 mM spermidine reduces cell viability to <0.1% compared to controls without spermidine

  • Expression of mdtJI increases viability >1,000-fold under these conditions

  • At higher spermidine concentrations (12 mM), growth inhibition is significantly reversed by mdtJI expression

  • The protective effect is more pronounced with high-copy (pUC) than low-copy (pMW) vectors expressing mdtJI

  • Neither mdtJ nor mdtI alone significantly increases cell viability

This indicates that the MdtJI complex provides critical protection against spermidine toxicity when normal metabolic pathways for spermidine detoxification are compromised .

How does the MdtJI complex compare functionally across different Salmonella species?

Comparative analysis of MdtJ proteins from different Salmonella species reveals:

Salmonella SpeciesMdtJ Sequence SimilarityFunctional Differences
S. arizonaeReference sequenceBaseline activity
S. typhiHigh conservationSimilar functionality
S. agonaHigh conservationSimilar functionality
S. dublinHigh conservationSimilar functionality

What control systems are essential when studying MdtJ function in spermidine transport?

When designing experiments to study MdtJ function, the following controls are crucial:

  • Genetic Controls:

    • Empty vector controls (without mdtJ or mdtI)

    • Single gene expression (mdtJ or mdtI alone)

    • Mutant constructs with alterations to key functional residues

  • Experimental Controls:

    • Spermidine concentration gradients (0-12 mM)

    • Varying expression levels using different vectors (high vs. low copy)

    • Time-course measurements to capture transport kinetics

  • Cell Viability Controls:

    • Wild-type cells with functional spermidine acetyltransferase

    • Cells in media without added spermidine

    • Complementation with other polyamine transporters

These control systems help isolate MdtJ-specific effects from general cellular responses to polyamine stress or expression of membrane proteins .

How can researchers differentiate between direct MdtJ-mediated export and indirect effects on spermidine homeostasis?

To distinguish direct MdtJ-mediated export from indirect effects:

  • Direct Measurement Approach:

    • Use radiolabeled ([14C]) spermidine to directly track export kinetics

    • Compare export rates between MdtJI-expressing cells and controls

    • Examine the effect of MdtJ mutations on export rates

  • Intracellular Analysis:

    • Quantify intracellular spermidine levels using HPLC or LC-MS

    • Compare spermidine content in cells expressing functional vs. non-functional MdtJ

    • Measure changes in other polyamines (putrescine, spermine) to detect compensatory mechanisms

  • Pathway Inhibition Studies:

    • Selectively inhibit other polyamine transport/metabolism pathways

    • Measure MdtJ-dependent export under these conditions

    • Use genetic knockouts of other polyamine-related genes

This multi-faceted approach helps establish causality between MdtJ function and observed changes in spermidine transport .

What are the common challenges in expressing and working with functional recombinant MdtJ?

Researchers often encounter these challenges when working with recombinant MdtJ:

  • Expression Challenges:

    • Toxicity to host cells due to membrane protein overexpression

    • Protein misfolding or aggregation

    • Formation of inclusion bodies

  • Solubilization Issues:

    • Difficulty maintaining native conformation during extraction

    • Detergent selection critical for maintaining functionality

    • Risk of losing interaction capability with MdtI

  • Activity Preservation:

    • Activity loss during purification steps

    • Stability concerns during storage

    • Functional reconstitution in artificial systems

To address these challenges, researchers should consider using specialized E. coli strains designed for membrane protein expression, optimizing induction conditions (lower temperatures, reduced inducer concentrations), and carefully selecting detergents compatible with membrane protein structure .

How can researchers overcome difficulties in reconstituting functional MdtJI complexes in vitro?

For successful reconstitution of functional MdtJI complexes:

  • Co-expression Strategies:

    • Design constructs for simultaneous expression of both MdtJ and MdtI

    • Use bicistronic vectors maintaining natural operon structure

    • Consider fusion constructs with flexible linkers

  • Membrane Mimetics:

    • Test various lipid compositions in proteoliposomes

    • Evaluate nanodiscs with different scaffold proteins

    • Consider amphipol-based stabilization

  • Functional Verification:

    • Develop in vitro transport assays using purified reconstituted complexes

    • Monitor spermidine movement across artificial membranes

    • Compare activity to whole-cell systems as benchmarks

The challenge of reconstituting functional complexes often requires empirical optimization of lipid composition, protein:lipid ratios, and buffer conditions specific to the experimental system .

What is the potential role of MdtJ in Salmonella virulence and host-pathogen interactions?

While direct evidence linking MdtJ to Salmonella virulence remains limited, several observations suggest potential relevance:

  • Polyamine homeostasis is critical during infection processes

  • Salmonella encounters varying polyamine concentrations within host environments

  • Salmonella arizonae infections, though rare in humans, can cause serious complications including gastroenteritis, bacteremia, and bone/joint infections

  • MdtJ may contribute to bacterial survival in polyamine-rich host environments

Future research directions should include:

  • Examining mdtJ expression during different stages of infection

  • Comparing virulence of wild-type and mdtJ-deficient Salmonella in animal models

  • Investigating host polyamine responses to Salmonella infection

  • Exploring potential interactions between MdtJ and host defense mechanisms .

How might MdtJ homologs across different bacterial species reflect evolutionary adaptations to specific ecological niches?

Comparative analysis of MdtJ across bacterial species reveals evolutionary patterns:

  • The MdtJ protein structure is conserved across Salmonella species, suggesting fundamental importance to cellular function

  • Subtle sequence variations exist between species that occupy different ecological niches

  • Regulatory mechanisms controlling mdtJ expression may differ based on environmental polyamine exposure patterns

This variation may reflect adaptations to:

  • Host-specific polyamine concentrations

  • Environmental polyamine sources

  • Competitive advantages in specific ecological niches

  • Differential requirements for polyamine homeostasis

Research comparing MdtJ function across Salmonella species isolated from different hosts (humans, reptiles, other animals) could provide insights into evolutionary adaptations to specific host environments .

What methodological approaches would best elucidate the structural mechanisms of MdtJ-mediated spermidine transport?

Advanced structural biology approaches for elucidating MdtJ transport mechanisms include:

  • Cryo-electron Microscopy:

    • Determine high-resolution structure of the MdtJI complex

    • Capture different conformational states during transport cycle

    • Visualize spermidine binding sites

  • Molecular Dynamics Simulations:

    • Model spermidine movement through the transport channel

    • Predict conformational changes during transport

    • Simulate effects of mutations on transport capability

  • Site-directed Spin Labeling and EPR Spectroscopy:

    • Monitor dynamic changes during substrate binding and transport

    • Measure distances between specific residues during transport cycle

    • Track conformational changes in real-time

  • In silico Docking and Molecular Modeling:

    • Predict spermidine binding sites within the MdtJI complex

    • Design targeted mutations to test binding hypotheses

    • Model interactions with membrane environment

These approaches, used in combination, would provide complementary insights into the structural basis of MdtJ-mediated spermidine transport .

How do sequence variations in MdtJ affect functional capabilities across different Salmonella strains?

Although the core functional residues of MdtJ are largely conserved across Salmonella species, minor sequence variations exist that may influence:

  • Transport efficiency and substrate specificity

  • Protein stability and membrane integration

  • Interaction strength with MdtI

  • Regulatory responsiveness to environmental signals

Comparative experimental analysis using recombinant MdtJ proteins from different Salmonella strains could reveal functional differences correlated with these sequence variations. This could provide insights into strain-specific adaptations for polyamine management in different host environments or ecological niches .

Could MdtJ be utilized as a target for developing novel antimicrobial strategies against Salmonella infections?

While primarily a research topic, MdtJ presents several attributes that make it a potential antimicrobial target:

  • Target Rationale:

    • Disruption of polyamine homeostasis could impair bacterial survival

    • Inhibiting MdtJ might lead to toxic spermidine accumulation in bacterial cells

    • The protein is membrane-localized and potentially accessible to inhibitors

  • Experimental Approaches:

    • Screen for small molecules that bind to and inhibit MdtJ function

    • Design peptide mimetics that disrupt MdtJ-MdtI complex formation

    • Develop targeted delivery systems for MdtJ inhibitors

  • Research Considerations:

    • Establish whether MdtJ is essential during in vivo infection

    • Determine if functional redundancy exists for spermidine export

    • Assess potential for resistance development

This represents a novel direction for antimicrobial research, especially for difficult-to-treat Salmonella arizonae infections, which can cause serious complications including bone and joint sepsis .

What insights does MdtJ research provide about Salmonella arizonae infections in clinical settings?

Research on MdtJ contributes to our understanding of Salmonella arizonae infections:

  • Salmonella arizonae is primarily associated with reptiles, with snakes being the most common reservoir

  • Human infections are rare but can occur in:

    • Young infants and immunocompromised individuals

    • Individuals with reptile exposure or consumption of snake-based products

    • Patients receiving snake-based traditional medications

  • Clinical presentations include:

    • Gastroenteritis (most common)

    • Bone and joint infections

    • Bacteremia and sepsis

    • Meningitis and other invasive infections

Understanding bacterial survival mechanisms, including polyamine management through proteins like MdtJ, may help explain the pathogen's ability to persist in diverse host environments and cause serious infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.