Recombinant Salmonella arizonae Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Stress Adaptation

As a member of the USP family, uspB likely contributes to stress resistance mechanisms, though direct functional studies remain limited. USPs in general:

  • Regulate ATP Binding: Many USPs bind ATP or its analogs, modulating metabolic pathways under stress .

  • Stabilize Cellular Components: Act as chaperones for proteins or RNA, preventing aggregation or degradation during oxidative, metabolic, or thermal stress .

  • Support Pathogen Survival: In Salmonella, USPs like UspA enhance virulence by aiding survival in host environments .

While uspB’s specific role is not fully characterized, its sequence similarity to E. coli USPs suggests involvement in stress-induced metabolic reprogramming or membrane stability .

Research Applications and Tools

uspB is primarily utilized in experimental workflows, including:

ELISA Kits

Recombinant uspB is used as an antigen in enzyme-linked immunosorbent assays to detect antibodies or study host-pathogen interactions .

Protein Expression Studies

Expression vectors encoding uspB enable heterologous production in E. coli, facilitating biochemical assays (e.g., ATP-binding assays, structural analysis via X-ray crystallography) .

Phylogenetic and Pathogenicity Research

Salmonella arizonae’s intermediate position between pathogenic and non-pathogenic Salmonella subgroups makes uspB a target for studying evolutionary adaptations in stress response and virulence .

Comparative Analysis with Related Proteins

FeatureuspBUspA (Salmonella typhimurium)
Expression HostE. coli Native host
Stress InducersInferred (based on USP family)Oxidative, metabolic, thermal
Pathogenic RoleHypothetical (under study)Confirmed (virulence in mice)
ApplicationsELISA, structural biology Virulence studies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please inform us and we will prioritize developing that tag.
Synonyms
uspB; SARI_04048; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
uspB
Target Protein Sequence
MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQM RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella arizonae and how does it relate to other Salmonella species?

Salmonella arizonae (also called Salmonella subgroup IIIa) is a Gram-negative, non-spore-forming, motile, rod-shaped, facultatively anaerobic bacterium. It occupies an evolutionary position between Salmonella subgroups I (which includes human pathogens) and V (also called S. bongori, which is usually non-pathogenic to humans). This intermediate position makes S. arizonae an ideal model organism for studying bacterial evolution toward human pathogenicity . S. arizonae strain RKS2983, which was isolated from a human in California, has a 4,574,836 bp complete genome containing 4,203 protein-coding genes, 82 tRNA genes, and 7 rRNA operons . Comparative genomic analyses have revealed that S. arizonae has 926 genes specific to its genome when compared with S. bongori and S. typhimurium LT2 .

What are Universal stress proteins and what functions do they serve in Salmonella?

Universal stress proteins (USPs) are a family of proteins that are produced by bacteria in response to various stress conditions. In Salmonella species, particularly in S. Enteritidis, uspA and uspB genes are highly expressed in hostile environments such as the chicken oviduct and eggs . Research indicates that these proteins are involved in conferring resistance against compounds that damage bacterial cell membranes and DNA, thereby facilitating long-term persistence in challenging environments . Expression studies have demonstrated that uspA and uspB gene expression is induced specifically after contact with egg white, suggesting their role in adaptation to this particular environment .

How can S. arizonae uspB be effectively cloned and expressed in laboratory settings?

Methodological Approach:

  • Vector Selection: Choose an expression vector compatible with Salmonella, such as the pCASP plasmid system which allows co-regulation with Salmonella pathogenicity island-1 (SPI-1) gene expression .

  • Primer Design: Design primers that specifically amplify the uspB gene from S. arizonae genomic DNA. Include appropriate restriction sites for subsequent cloning steps.

  • PCR Amplification: Optimize PCR conditions for high-fidelity amplification of the uspB gene:

    • Initial denaturation: 95°C for 5 minutes

    • 30 cycles of: denaturation at 95°C for 30 seconds, annealing at 55-60°C for 30 seconds, extension at 72°C for 1 minute

    • Final extension: 72°C for 10 minutes

  • Cloning Strategy: Clone the amplified uspB gene into the selected expression vector. Consider adding tag sequences (e.g., 3×FLAG tag) for downstream detection and purification .

  • Transformation: Transform the recombinant plasmid into an appropriate E. coli strain for plasmid propagation, then into an attenuated Salmonella strain for expression studies.

  • Expression Verification: Confirm expression using Western blot analysis with antibodies against the tagged recombinant protein.

What are the key challenges in identifying and working with S. arizonae in clinical and research settings?

Identification of S. arizonae presents several challenges in both clinical and research contexts. Routine biochemical tests and serological reagents often struggle to accurately identify this organism . In clinical settings, its rarity as a human pathogen may lead to misidentification or overlooking its presence entirely. When working with suspected S. arizonae isolates, molecular techniques such as Salmonella-specific PCR represent valuable tools for confirming etiology and should be employed alongside traditional methods .

For researchers, additional challenges include the organism's complex taxonomy and the need for specialized safety protocols when working with potentially pathogenic strains. S. arizonae is primarily associated with reptiles, particularly snakes, and has been implicated in severe infections in immunocompromised individuals and infants . Therefore, proper biosafety measures must be maintained throughout experimental procedures.

How can SSED approaches be applied to investigate the role of recombinant S. arizonae uspB in bacterial stress responses?

Single-subject experimental designs (SSEDs) offer valuable approaches for investigating stress protein function in bacteria. When applying SSED to study recombinant S. arizonae uspB, researchers should implement the following methodological framework:

  • Establish Stable Baseline Measurements: Before introducing stressors or modifying uspB expression, collect multiple baseline measurements of key parameters such as growth rate, membrane integrity, and survival under standard conditions .

  • Implement Phase Changes Systematically: Introduce experimental interventions (e.g., different stressors, varying uspB expression levels) in a systematic, stepwise manner that allows clear attribution of observed effects to specific variables .

  • Measure Multiple Dependent Variables: Track several stress response indicators simultaneously, including:

    • Growth rates in selective media

    • Membrane permeability changes

    • Protein expression profiles

    • Survival rates under stress conditions

  • Replicate Effects Within the Study: Design experiments to demonstrate the same effect multiple times under different conditions to establish internal validity . For example, show that uspB upregulation consistently correlates with improved survival across different stressors.

  • Visual and Statistical Analysis: Apply both visual analysis methods (examining changes in level, trend, and variability) and appropriate statistical techniques to evaluate experimental effects .

This approach enables researchers to determine causal relationships between uspB expression and specific stress responses while controlling for confounding variables.

What genomic and proteomic approaches can be used to elucidate the complete functional profile of S. arizonae uspB?

Comprehensive Functional Characterization Strategy:

  • Comparative Genomic Analysis:

    • Analyze the uspB gene and its genomic context across multiple Salmonella strains and related species

    • Identify conserved domains, regulatory elements, and potential interaction partners

    • Map evolutionary relationships to understand functional diversification

  • Transcriptomic Profiling:

    • Employ RNA-Seq to measure global transcriptional changes in wild-type versus uspB mutant strains under various stress conditions

    • Identify co-regulated genes that may function in the same pathways

    • Map regulatory networks involving uspB

  • Proteomic Approaches:

    • Utilize pull-down assays with tagged recombinant uspB to identify protein-protein interactions

    • Apply mass spectrometry to characterize post-translational modifications

    • Perform differential proteomics comparing wild-type and uspB mutant strains

  • Structural Biology:

    • Determine the three-dimensional structure of uspB using X-ray crystallography or NMR spectroscopy

    • Map functional domains and identify potential ligand-binding sites

    • Conduct molecular dynamics simulations to understand conformational changes under stress conditions

  • Metabolomic Analysis:

    • Profile metabolite changes in response to uspB expression/deletion

    • Identify metabolic pathways affected by uspB activity

Integration of these multi-omics approaches provides a comprehensive understanding of uspB function beyond what any single technique could reveal .

How does the function of uspB in S. arizonae compare with homologous proteins in other Salmonella subspecies, particularly regarding stress resistance mechanisms?

Comparative Functional Analysis Methodology:

While limited specific data exists on S. arizonae uspB, researchers can implement the following comparative approach:

  • Sequence and Structural Homology Analysis:

    • Align uspB sequences from S. arizonae, S. enterica subspecies enterica (including serovar Enteritidis), and S. bongori

    • Identify conserved domains and subspecies-specific variations

    • Model protein structures to predict functional differences

  • Complementation Studies:

    • Generate uspB deletion mutants in multiple Salmonella subspecies

    • Perform cross-complementation experiments by expressing S. arizonae uspB in other subspecies' mutants and vice versa

    • Measure restoration of stress resistance phenotypes

  • Stress Response Profiling:

    • Compare growth curves of wild-type and uspB mutants from different subspecies under various stress conditions (oxidative stress, acid stress, antimicrobial exposure)

    • Measure survival rates in environmental samples that mimic natural reservoirs (reptile gut, egg white)

    • Track membrane integrity changes using fluorescent dyes

What are the most effective genetic modification strategies for creating recombinant S. arizonae strains with altered uspB expression for research purposes?

Genetic Modification Approach:

  • Gene Deletion Strategies:

    • Utilize λ Red recombinase system for precise deletion of uspB

    • Design targeting constructs with antibiotic resistance cassettes flanked by FRT sites

    • Confirm deletions by PCR and sequencing

    • Remove selection markers using FLP recombinase for markerless mutations

  • Controlled Expression Systems:

    • Integrate inducible promoters (e.g., arabinose-inducible PBAD, tetracycline-responsive systems) upstream of uspB

    • Create translational fusions with fluorescent proteins for real-time expression monitoring

    • Develop dual-control systems allowing both repression and induction

  • Site-Directed Mutagenesis:

    • Identify critical residues through structural analysis and conservation patterns

    • Generate point mutations using overlap extension PCR

    • Create libraries of variants using saturation mutagenesis

  • Chromosomal Integration Methods:

    • Employ CRISPR-Cas9 technology for precise genomic editing

    • Use transposon-based systems for random integration and subsequent selection

    • Apply counterselection methods (e.g., sacB) for markerless modifications

  • Verification and Characterization:

    • Confirm genetic modifications by whole-genome sequencing

    • Validate expression changes at mRNA (qRT-PCR) and protein (Western blot) levels

    • Assess phenotypic consequences through growth and stress resistance assays

These approaches enable the creation of defined genetic backgrounds for studying uspB function while minimizing polar effects and unintended mutations.

What is the optimal experimental design for studying the role of recombinant S. arizonae uspB in bacterial pathogenicity?

Comprehensive Experimental Framework:

  • Strain Construction:

    • Wild-type S. arizonae (reference strain)

    • ΔuspB deletion mutant

    • Complemented strain (ΔuspB + plasmid-expressed uspB)

    • Overexpression strain (wild-type + additional uspB copies)

    • Strains expressing tagged versions (e.g., FLAG-tagged) of uspB

  • In Vitro Virulence Assays:

    • Invasion assays using relevant cell lines (e.g., intestinal epithelial cells)

    • Intracellular survival assays in macrophages

    • Biofilm formation assessment

    • Motility assays (swimming, swarming)

    • Resistance to antimicrobial peptides and oxidative stress

  • Ex Vivo Models:

    • Survival in egg white (particularly relevant given uspB induction in this environment in S. Enteritidis)

    • Persistence in organ explants (e.g., intestinal tissue)

  • Animal Models (with appropriate ethical approval):

    • Colonization studies in reptile models (natural hosts)

    • Pathogenicity assessment in immunocompromised mouse models

    • Competition assays between wild-type and mutant strains

  • Data Analysis Approach:

    • Compare colonization/invasion efficiency between strains

    • Analyze time-course data for persistence

    • Apply statistical methods appropriate for the experimental design

    • Implement multivariate analysis to identify correlations between uspB expression and virulence phenotypes

This systematic approach allows researchers to establish causal relationships between uspB function and pathogenicity traits while controlling for genetic background effects.

How can researchers address data inconsistencies and contradictions in uspB functional studies?

Methodological Framework for Resolving Data Inconsistencies:

  • Standardize Experimental Conditions:

    • Develop detailed protocols specifying media composition, growth conditions, and assay parameters

    • Establish reference strains that are used consistently across laboratories

    • Implement quality control measures for reagents and biological materials

  • Statistical Approaches:

    • Conduct power analyses to ensure adequate sample sizes

    • Apply appropriate statistical tests based on data distribution

    • Use multiple comparison corrections when analyzing complex datasets

    • Implement mixed-effects models to account for batch and laboratory variations

  • Meta-Analysis Techniques:

    • Systematically review published literature on uspB function

    • Extract quantitative data from multiple studies for formal meta-analysis

    • Identify moderating variables that may explain inconsistent results

  • Reproducibility Strategies:

    • Perform independent replications of key experiments

    • Vary experimental conditions systematically to identify context-dependent effects

    • Use multiple methodological approaches to address the same research question

  • Collaborative Approaches:

    • Establish multi-laboratory validation studies

    • Develop shared resources and standardized materials

    • Implement open data practices to facilitate comparison across studies

When facing conflicting results regarding uspB function, researchers should consider that discrepancies may reflect biological realities rather than methodological failures. The function of stress proteins often depends on specific environmental conditions, genetic background, and complex regulatory networks that may vary between experimental systems.

What data supports the role of uspB in S. arizonae stress resistance and survival?

Table 2: Optimization Parameters for Recombinant S. arizonae uspB Expression

Optimization ParameterRecommended ApproachTechnical ConsiderationsValidation Methods
Expression VectorpCASP plasmid systemAllows co-regulation with SPI-1 gene expressionWestern blot, qRT-PCR
Tagging StrategyN-terminal SptP167 fusion, C-terminal 3×FLAGSptP167 contains secretion signal and chaperone binding domainSecretion assays, immunodetection
Host Strain SelectionAttenuated S. typhimurium (SopA- and SsaK-)Reduced virulence while maintaining functional T3SSSafety verification, growth curves
Induction ConditionsSPI-1 inducing conditions (high salt, low oxygen)Maximizes expression through native regulatory systemsProtein yield quantification
Purification StrategyAffinity chromatography using FLAG epitopeEnables single-step purificationSDS-PAGE, mass spectrometry
Detection MethodsFLAG antibodies, uspB-specific antibodiesMultiple detection options increase experimental flexibilityWestern blot, ELISA

For optimal expression of recombinant S. arizonae uspB, researchers should consider the physiological context of the protein's native expression. Since uspB is typically induced under stress conditions, incorporating relevant stressors during the expression phase may enhance protein yield and ensure proper folding of the recombinant product.

What emerging technologies could advance our understanding of S. arizonae uspB function?

Methodological Approaches for Future Research:

  • CRISPR Interference (CRISPRi) for Tunable Gene Regulation:

    • Implement dCas9-based systems for precise control of uspB expression

    • Create expression gradients to identify threshold levels required for stress protection

    • Study dosage effects on various phenotypes

  • Single-Cell Analysis Techniques:

    • Apply flow cytometry and fluorescence microscopy to study cell-to-cell variation in uspB expression

    • Utilize single-cell RNA-Seq to identify subpopulations with distinct stress response profiles

    • Implement microfluidic systems to track individual bacterial cells under changing stress conditions

  • Protein-Protein Interaction Networks:

    • Apply proximity labeling approaches (BioID, APEX) to identify interacting partners in living cells

    • Utilize protein complementation assays to validate specific interactions

    • Map complete interaction networks under different stress conditions

  • Structural Biology Advances:

    • Implement cryo-electron microscopy for structural analysis of uspB complexes

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Utilize neutron scattering techniques to analyze hydration patterns and molecular dynamics

  • Systems Biology Integration:

    • Develop mathematical models of stress response pathways incorporating uspB

    • Implement machine learning approaches to predict uspB function in novel contexts

    • Create genome-scale metabolic models to understand uspB's role in cellular physiology

These emerging technologies will enable researchers to move beyond correlative studies toward mechanistic understanding of uspB function in S. arizonae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.