Recombinant Salmonella arizonae UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock
Cat. No.
BT2116805
Source
in vitro E.coli expression system
Synonyms
yciC; SARI_01220; UPF0259 membrane protein YciC
Quick Inquiry

Description

Protein Overview

Recombinant Salmonella arizonae UPF0259 membrane protein YciC (yciC) is a bacterial membrane-associated protein produced through recombinant DNA technology. It belongs to the UPF0259 family, a group of conserved prokaryotic proteins with roles in membrane integrity and bacterial physiology. This protein is derived from Salmonella enterica subspecies arizonae, a zoonotic pathogen associated with reptile-linked salmonellosis in humans .

Expression and Purification

  • Expression System: Mammalian cell or E. coli (varies by vendor) .

  • Tag: His-tag (N- or C-terminal, determined during production) .

  • Protein Length: Full-length (1–247 amino acids) .

  • Purity: >85% (SDS-PAGE) .

Biochemical Properties

ParameterSpecification
FormLyophilized powder or liquid (Tris/PBS-based buffer with 50% glycerol) .
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles .
Reconstitution0.1–1.0 mg/mL in sterile water; add glycerol for long-term storage .
StabilityWorking aliquots stable at 4°C for ≤1 week .

Antibody Production

YciC serves as an immunogen for generating antibodies in ELISA and Western blot assays .

Mechanistic Studies

  • Membrane Dynamics: Used to study bacterial membrane protein interactions .

  • Drug Target Exploration: Potential candidate for anti-Salmonella therapeutics due to its role in energy metabolism .

Comparative Analysis with Related Proteins

FeatureS. arizonae YciC S. Typhimurium YqiC
UniProt IDA9MPE1B4SUC3 (Newport) / B4TX47 (Schwarzengrund)
Oligomeric StateNot yet confirmedHomotrimer
FunctionMembrane integrityETC modulation, virulence

Challenges and Future Directions

  • Structural Resolution: No crystal structure is available; cryo-EM studies are needed.

  • In Vivo Validation: Role in S. arizonae pathogenicity requires direct infection models .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciC; SARI_01220; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVILGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMSPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMSIVLALAPVMLVEEKMGVFTAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSLAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.
A9MPE1

Target Background

Database Links

KEGG: ses:SARI_01220

STRING: 882884.SARI_01220

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.