Recombinant Salmonella arizonae UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Introduction

Salmonella arizonae is a subspecies of Salmonella enterica known to cause salmonellosis, a common bacterial infection . The UniProt database identifies Salmonella enterica subsp. arizonae as a source of protein sequence and functional information . Recombinant proteins, like the UPF0283 membrane protein YcjF, are produced using genetic engineering techniques, allowing for detailed study and potential applications in vaccine development and diagnostics .

General Information

The protein in question is annotated as UPF0283 membrane protein YcjF. UPF0283 signifies a protein of unknown function, highlighting that its precise biological role is not yet fully understood . YcjF is a designation given to this protein within Salmonella arizonae. As a membrane protein, YcjF is located within the cell membrane, which is crucial for interaction with the external environment and other cells.

Role in Salmonella

Outer membrane proteins (OMPs) like YcjF are vital for maintaining the integrity and selective permeability of the bacterial outer membrane . OMPs are potential drug and vaccine targets because of their high immunogenicity and safety . Some Salmonella OMPs can influence the host's immune response by affecting the complement system . This can be crucial for the bacterium's survival and pathogenicity.

Recombinant Production

Recombinant production involves generating the protein in a controlled environment, often using bacterial expression systems. This allows researchers to produce large quantities of the protein for characterization and experimentation .

Immune Response and Complement Activation

Salmonella bacteria containing sialic acid in their lipopolysaccharide (LPS) can evade the host's immunological response by mimicking the host's tissues . The activation of the C3 serum protein is dependent on the sialic acid content in the LPS and the presence of OMPs . OMPs isolated from Salmonella strains bind C3 protein fragments, indicating their involvement in complement system modulation .

OmpC Porin Conservation

The Salmonella outer membrane porins OmpC and OmpF are highly immunogenic antigens that efficiently elicit protective antibodies . Conserved regions within OmpC porins have been identified, some of which are exclusive to Salmonella, suggesting they could induce a Salmonella-specific immune response . These conserved sequences are located along the β-sheets and periplasmic turns of the OmpC porin β-barrel .

Potential for Vaccine Development

Given that porins are highly immunogenic and protective vaccine candidates against Salmonella infections, understanding the antigen specificity of Salmonella porins is crucial for designing broad-spectrum vaccines . Modifying the outer membrane through the deletion of major OMPs may affect cross-protection with outer membrane vesicles by influencing the expression of conserved OMPs .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
ycjF; SARI_01297; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEESTSTFKAQQTFSEVESRTFSPAAIDEYPEDEGTAEAAVDAAL QPKRSLWRKMVLGGLALFGASVVGQGIQWTMNAWQTQDWAALGGCAAGALIIGAGVGSVI TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAYCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQPVLDAQARREVSRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIAALYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKTMELCRPLPWFDDDKPRLGDFRRQLIGQLKETLQKNKPTPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Salmonella arizonae UPF0283 membrane protein ycjF?

Salmonella arizonae UPF0283 membrane protein ycjF is a full-length protein consisting of 353 amino acids with UniProt accession number A9MQ55. The protein's amino acid sequence is: MSEPLKPRIDFAEPLKEESTSTFKAQQTFSEVESRTFSPAAIDEYPEDEGTAEAAVDAALQPKRSLWRKMVLGGLALFGASVVGQGIQWTMNAWQTQDWAALGGCAAGALIIGAGVGSVITEWRRLWRLRQRAHERDEARELLHSHSVGKGRAYCEKLAQQAGIDQSHPALQRWYAAIHETQNDREIVGLYAHLVQPVLDAQARREVSRFAAESTLMIAVSPLALVDMAFIAWRNLRLINRIAALYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIGAGLLTARLGIKTMELCRPLPWFDDDKPRLGDFRRQLIGQLKETLQKNKPTPEK . As suggested by its name, it is a membrane-associated protein with a predicted structure that includes transmembrane domains typical of membrane-spanning proteins in Gram-negative bacteria.

How is the recombinant Salmonella arizonae ycjF protein typically expressed and purified for research purposes?

The recombinant Salmonella arizonae ycjF protein can be expressed using several expression systems depending on research requirements. Common expression systems include Escherichia coli, yeast, baculovirus-infected insect cells, or mammalian cell expression systems . For most basic research applications, E. coli expression systems are preferred due to their cost-effectiveness and high yield.

For purification, a methodological approach typically involves:

  • Selection of an appropriate expression vector with a fusion tag (His-tag, GST, etc.)

  • Transformation into the selected expression host

  • Optimization of growth conditions (temperature, IPTG concentration, induction time)

  • Cell lysis using appropriate buffers containing detergents suitable for membrane proteins

  • Affinity chromatography based on the fusion tag

  • Size exclusion chromatography for further purification

  • Storage in Tris-based buffer with 50% glycerol to maintain stability

The choice of expression system should be guided by the specific experimental requirements, particularly when studying protein folding, post-translational modifications, or when preparing samples for structural analysis.

What are the optimal conditions for preserving structure and activity of recombinant ycjF protein during laboratory handling?

Maintaining the structural integrity and functional activity of recombinant ycjF protein requires careful attention to storage and handling conditions. The optimal protocol includes:

  • Storage temperature: Store at -20°C for standard use, and at -80°C for extended storage periods

  • Buffer composition: Use Tris-based buffer with 50% glycerol as a cryoprotectant, optimized specifically for this membrane protein

  • Avoid freeze-thaw cycles: Repeated freezing and thawing significantly reduces protein stability and activity

  • Working aliquots: Prepare smaller working aliquots and store at 4°C for up to one week

  • Handling during experiments: Maintain samples on ice when actively working with the protein

  • Detergent considerations: When working with this membrane protein, include appropriate detergents at concentrations above their critical micelle concentration to maintain native-like folding

These storage and handling conditions are essential to preserve the membrane protein's native conformation, especially given the complex transmembrane domains typically found in UPF0283 family proteins.

What detection methods are most effective for studying ycjF protein in complex biological samples?

When investigating ycjF protein in complex biological samples, several methodological approaches have proven effective, each with specific advantages:

Detection MethodSensitivitySpecificityApplication ScenariosLimitations
Western BlottingModerateHighProtein expression levels, molecular weight confirmationRequires specific antibodies
ELISAHighHighQuantitative detection in various sample typesCross-reactivity concerns with polyclonal antibodies
Mass SpectrometryVery HighVery HighPrecise identification, post-translational modificationsExpensive equipment, complex sample preparation
PCR for ycjF geneHighHighPresence of gene in samples, transcription studiesDetects gene not protein
ImmunohistochemistryModerateModerate-HighLocalization in tissue samplesTissue processing can affect epitope recognition

For maximum reliability, a multi-method approach is recommended. For example, PCR detection of the ycjF gene (similar to the invA gene detection method described for related Salmonella ) combined with Western blotting for protein confirmation provides complementary data that strengthens research findings.

How does the expression of ycjF differ between virulent and avirulent strains of Salmonella?

This question addresses a critical aspect of understanding the role of ycjF in Salmonella pathogenesis. While current research specifically comparing ycjF expression between virulent and avirulent strains is limited, a methodological approach to investigate this question would include:

  • Comparative transcriptomics: RNA-seq or microarray analysis of virulent versus avirulent strains under various environmental conditions (host-mimicking environments, stress conditions)

  • Quantitative proteomics: MS-based quantitative proteomics to measure protein abundance differences between strain types

  • Reporter gene assays: Construction of ycjF promoter-reporter fusions to monitor expression levels in different genetic backgrounds

  • Environmental response studies: Analysis of ycjF expression in response to host environmental factors (pH changes, antimicrobial peptides, nutrient limitation)

  • In vivo expression technology (IVET): To determine if ycjF is differentially expressed during infection

Preliminary evidence from studies on related Salmonella subspecies suggests that membrane proteins can contribute to colonization capability and persistence in host tissues. For example, S. enterica subsp. diarizonae has been recovered from various tissues including the small intestine and liver in experimental infection models , indicating that membrane proteins may play important roles in the colonization process.

How conserved is the ycjF protein sequence across different Salmonella species and what does this suggest about its functional importance?

The conservation of protein sequences across species often indicates functional importance. For the ycjF protein, a comprehensive sequence alignment analysis across Salmonella species would reveal regions of high conservation that likely correspond to functionally critical domains.

Methodological approach to assess conservation:

  • Retrieve ycjF protein sequences from various Salmonella species and subspecies

  • Perform multiple sequence alignment using tools such as CLUSTAL Omega or MUSCLE

  • Calculate sequence identity and similarity percentages

  • Identify highly conserved domains or motifs

  • Construct phylogenetic trees to visualize evolutionary relationships

The UPF0283 family, to which ycjF belongs, is distributed across Salmonella species. Comparing S. arizonae ycjF with related proteins in other subspecies like S. enterica subsp. diarizonae (which has at least 336 distinct serovars, representing approximately 13% of all recorded serovars in the S. enterica species ) would provide insights into evolutionary conservation.

Highly conserved regions would be prime candidates for functional importance and could guide site-directed mutagenesis studies to determine their specific roles in protein function. Conversely, variable regions might indicate adaptation to specific host environments or physiological niches.

What structural and functional similarities exist between ycjF and other membrane proteins involved in bacterial pathogenesis?

Understanding the structural and functional relationships between ycjF and other bacterial pathogenesis-related membrane proteins can provide valuable insights into its potential role in virulence. A methodological approach to this comparative analysis includes:

  • Structural comparison: Using bioinformatics tools to predict secondary and tertiary structures, and comparing these with known structures of virulence-associated membrane proteins

  • Domain analysis: Identification of conserved domains or motifs shared with:

    • Adhesins that mediate attachment to host cells

    • Invasins that facilitate bacterial entry

    • Secretion system components

    • Transporters involved in nutrient acquisition during infection

  • Functional prediction: Based on structural similarities, predict potential functions such as:

    • Host cell binding

    • Immune evasion

    • Nutrient acquisition

    • Signal transduction

  • Experimental validation: Design experiments to test predicted functions, such as:

    • Protein-protein interaction studies

    • Host cell binding assays

    • Comparative virulence studies with knockout mutants

While specific data directly comparing ycjF with other pathogenesis-related proteins is limited, the methodological framework outlined above provides a scientifically rigorous approach to investigating these relationships.

What are the challenges and solutions in designing knockout studies to investigate ycjF function in Salmonella arizonae?

Designing effective knockout studies for ycjF in Salmonella arizonae presents several technical challenges that require careful methodological considerations:

ChallengeMethodological Solution
Potential essentiality of ycjFUse conditional knockout systems (temperature-sensitive promoters or inducible expression)
Polar effects on adjacent genesDesign clean deletion strategies that preserve reading frames and regulatory elements
Complementation controlsCreate complementation constructs with ycjF under native or inducible promoters
Phenotypic assessmentDevelop comprehensive assays to detect subtle phenotypic changes (growth curves, stress resistance, virulence)
Host interaction studiesDesign infection models appropriate for S. arizonae's natural host range

The experimental workflow should include:

  • Bioinformatic analysis of the ycjF genomic context to understand potential polar effects

  • PCR amplification of flanking regions for homologous recombination

  • Construction of knockout vectors with appropriate selection markers

  • Transformation and selection of recombinants

  • Verification of gene deletion by PCR and sequencing

  • Complementation with wild-type ycjF

  • Phenotypic characterization comparing wild-type, knockout, and complemented strains

Considering the potential membrane localization of ycjF, particular attention should be given to membrane integrity assays and envelope stress responses when phenotyping the knockout mutants.

How can advanced imaging techniques be applied to study the localization and dynamics of ycjF in living bacterial cells?

Advanced imaging techniques provide powerful tools for investigating the subcellular localization and dynamics of membrane proteins like ycjF in living Salmonella cells. A methodological approach includes:

  • Fluorescent protein fusion construction:

    • C-terminal and N-terminal GFP/mCherry fusions with ycjF

    • Verification that fusion proteins maintain functionality

    • Expression under native promoter to maintain physiological levels

  • Super-resolution microscopy techniques:

    • Structured Illumination Microscopy (SIM) for 2x conventional resolution

    • Stimulated Emission Depletion (STED) microscopy for ~50 nm resolution

    • Single-Molecule Localization Microscopy (PALM/STORM) for ~20 nm resolution

    • Expansion microscopy for physical sample enlargement

  • Live-cell imaging protocols:

    • Microfluidic devices for controlled environment during imaging

    • Minimal media formulations to reduce autofluorescence

    • Optimization of acquisition parameters to minimize phototoxicity

  • Colocalization studies:

    • Dual-color imaging with markers for specific membrane domains

    • Quantitative colocalization analysis using Pearson's or Mander's coefficients

  • Protein dynamics studies:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure mobility

    • Single-particle tracking to follow individual protein molecules

    • Fluorescence Correlation Spectroscopy (FCS) for diffusion measurements

These advanced imaging approaches would provide unprecedented insights into the spatial organization of ycjF within the bacterial membrane, potentially revealing associations with specific membrane domains or macromolecular complexes that could inform its functional role.

How can recombinant ycjF protein be utilized in developing detection methods for Salmonella arizonae in research and diagnostic settings?

Recombinant ycjF protein offers significant potential for developing sensitive and specific detection methods for Salmonella arizonae. A methodological framework for such applications includes:

  • Antibody production and validation:

    • Immunization with purified recombinant ycjF protein

    • Screening and selection of high-affinity antibodies

    • Validation for specificity across related Salmonella species

    • Development of monoclonal antibodies for standardized assays

  • Immunoassay development:

    • ELISA formats (direct, sandwich, competitive) optimized for ycjF detection

    • Lateral flow immunoassays for rapid field testing

    • Immunomagnetic separation techniques for sample enrichment

  • Molecular beacon and aptamer design:

    • Selection of aptamers with high affinity for ycjF

    • Development of molecular beacons for real-time detection

    • Integration with isothermal amplification methods

  • Biosensor platforms:

    • Surface plasmon resonance (SPR) biosensors using anti-ycjF antibodies

    • Electrochemical impedance spectroscopy methods

    • Quartz crystal microbalance (QCM) sensors

The validation process should include comprehensive testing against:

  • Related Salmonella subspecies and serovars

  • Common environmental microbiota

  • Various sample matrices (clinical, food, environmental)

The detection limit, sensitivity, and specificity should be benchmarked against gold standard methods such as culture-based techniques and PCR detection of genes like invA, which has been successfully used for detection of related Salmonella subspecies .

What are the key considerations when designing experimental protocols to study protein-protein interactions involving ycjF?

Investigating protein-protein interactions (PPIs) involving membrane proteins like ycjF presents unique challenges due to their hydrophobic nature and native membrane environment. A comprehensive methodological approach should consider:

  • Sample preparation considerations:

    • Membrane protein solubilization methods (detergents, nanodiscs, liposomes)

    • Choice of detergents that maintain native interactions

    • Tag positioning to avoid interference with interaction domains

    • Expression levels that mimic physiological conditions

  • In vitro interaction methods:

    • Pull-down assays with purified recombinant proteins

    • Surface Plasmon Resonance (SPR) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for solution-based binding studies

  • In vivo interaction techniques:

    • Bacterial Two-Hybrid systems adapted for membrane proteins

    • Förster Resonance Energy Transfer (FRET) with fluorescent protein fusions

    • Bimolecular Fluorescence Complementation (BiFC)

    • Proximity Ligation Assay (PLA) for detecting interactions in fixed samples

  • Mass spectrometry-based approaches:

    • Cross-linking Mass Spectrometry (XL-MS) to capture transient interactions

    • Co-immunoprecipitation followed by MS identification

    • Hydrogen-Deuterium Exchange MS for mapping interaction surfaces

  • Data analysis and validation:

    • Statistical analysis of interaction data

    • Computational modeling of interaction interfaces

    • Mutational analysis to confirm critical residues

    • Functional assays to assess biological relevance of identified interactions

When studying ycjF interactions, particular attention should be paid to potential interactions with components of bacterial secretion systems, stress response proteins, or host cell receptors, which might provide insights into its role in bacterial physiology or pathogenesis.

What are the most significant knowledge gaps in our understanding of ycjF function and how might they be addressed?

Despite advances in bacterial protein research, several critical knowledge gaps remain in our understanding of ycjF function:

  • Structural characterization gap:
    Current limitation: Lack of high-resolution structural data for ycjF
    Methodological approach: Apply cryo-electron microscopy or X-ray crystallography to purified protein in appropriate membrane mimetics

  • Functional annotation gap:
    Current limitation: Unclear precise cellular function despite UPF0283 family classification
    Methodological approach: Combine phenotypic screening of knockout mutants with transcriptomic and metabolomic profiling under various conditions

  • Evolutionary context gap:
    Current limitation: Limited understanding of conservation and divergence across species
    Methodological approach: Comprehensive phylogenetic analysis combined with structural modeling to identify functionally important conserved regions

  • Host interaction gap:
    Current limitation: Unknown whether ycjF interacts with host factors during infection
    Methodological approach: Host-pathogen protein interaction screens using methods adapted for membrane proteins

  • Regulation gap:
    Current limitation: Limited knowledge of how ycjF expression is regulated
    Methodological approach: Promoter analysis, transcription factor binding studies, and environmental response profiling

Addressing these gaps requires integrative approaches combining structural biology, functional genomics, and infection models. Particularly promising would be studies comparing ycjF function across different Salmonella subspecies, including S. enterica subsp. diarizonae, which has been studied in infection models and shown to colonize various tissues .

How might recombinant ycjF be utilized in developing new antimicrobial strategies against Salmonella infections?

The exploration of recombinant ycjF as a target for novel antimicrobial strategies represents an important frontier in Salmonella research. A methodological framework for this application includes:

  • Target validation approaches:

    • Assessment of ycjF essentiality under various growth conditions

    • Determination of virulence attenuation in ycjF mutants

    • Evaluation of conservation across clinically relevant Salmonella strains

    • Structural and functional distinction from host proteins

  • Inhibitor development strategies:

    • Structure-based virtual screening against modeled ycjF binding sites

    • Fragment-based drug discovery approaches

    • High-throughput screening of compound libraries

    • Rational design of peptide inhibitors targeting critical domains

  • Vaccine development potential:

    • Evaluation of recombinant ycjF as a vaccine antigen

    • Design of attenuated strains with modified ycjF

    • Development of subunit vaccines incorporating ycjF epitopes

    • Assessment of protective immunity in animal models

  • Alternative therapeutic approaches:

    • Antisense oligonucleotides targeting ycjF mRNA

    • CRISPR-Cas delivery systems for targeted gene disruption

    • Anti-virulence strategies focusing on ycjF-dependent processes

  • Combinatorial approaches:

    • Synergistic effects with conventional antibiotics

    • Multi-target strategies addressing redundant virulence pathways

The methodological assessment should include robust in vitro and in vivo models to evaluate efficacy, specificity, and potential resistance development. Comparative studies with related Salmonella subspecies would provide valuable insights into the broad applicability of any developed antimicrobial strategies.

What controls and validation steps are essential when studying recombinant ycjF protein to ensure experimental reliability?

Ensuring experimental reliability when working with recombinant ycjF protein requires comprehensive controls and validation steps throughout the research process:

Experimental StageEssential Controls and Validation Steps
Protein Expression- Empty vector control
- Western blot confirmation of correct molecular weight
- Mass spectrometry validation of protein identity
- Assessment of potential fusion tag effects
Protein Purification- Purity assessment by SDS-PAGE
- Integrity verification by mass spectrometry
- Endotoxin testing for in vivo applications
- Stability testing under experimental conditions
Functional Assays- Heat-inactivated protein controls
- Concentration-dependent response curves
- Time-course measurements
- Biological replicates from independent preparations
Antibody Studies- Pre-immune serum controls
- Isotype controls
- Cross-reactivity assessment with related proteins
- Verification with multiple antibody clones
In vivo Studies- Sham-treated controls
- Vehicle controls
- Dose-response relationships
- Statistical power calculations

Additional methodological considerations include:

  • Batch-to-batch consistency assessment for long-term studies

  • Storage stability monitoring with functional verification

  • Development of quantitative assays for protein activity

  • Establishment of reference standards when possible

When working with membrane proteins like ycjF, special attention should be given to maintaining native-like membrane environments during purification and functional studies. The storage conditions in Tris-based buffer with 50% glycerol as recommended should be rigorously maintained to ensure protein stability.

How can researchers effectively troubleshoot common challenges in expression and purification of recombinant ycjF protein?

Expression and purification of membrane proteins like ycjF present unique challenges that require systematic troubleshooting approaches:

  • Low expression yield challenges:

    • Problem: Membrane protein toxicity or inclusion body formation

    • Methodological solutions:

      • Reduce induction temperature (16-20°C)

      • Use specialized expression strains (C41/C43, BL21-AI)

      • Test different fusion tags (SUMO, MBP, TrxA)

      • Optimize codon usage for expression host

      • Explore cell-free expression systems

  • Solubilization challenges:

    • Problem: Inefficient extraction from membranes

    • Methodological solutions:

      • Screen multiple detergents (DDM, LMNG, CHAPS)

      • Test detergent-lipid mixtures

      • Optimize detergent-to-protein ratios

      • Consider native nanodiscs or styrene maleic acid copolymer extraction

  • Purification challenges:

    • Problem: Co-purification of contaminants or aggregation

    • Methodological solutions:

      • Implement multi-step purification (affinity, ion exchange, size exclusion)

      • Add stabilizing ligands during purification

      • Optimize salt concentration and pH

      • Include mild reducing agents to prevent disulfide-mediated aggregation

  • Activity loss challenges:

    • Problem: Loss of native conformation during purification

    • Methodological solutions:

      • Maintain critical lipids throughout purification

      • Optimize buffer composition (glycerol, salt, pH)

      • Minimize purification time and temperature

      • Consider reconstitution into proteoliposomes or nanodiscs

  • Validation and quality control:

    • Size exclusion chromatography to assess monodispersity

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to evaluate stability

    • Functional assays specific to predicted protein activity

For successful storage, the recommended conditions of -20°C in Tris-based buffer with 50% glycerol should be followed, with avoidance of repeated freeze-thaw cycles that can destabilize membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.