Recombinant Salmonella arizonae UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can accommodate specific format requests. Please specify your desired format in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
yjjB; SARI_03035; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
yjjB
Target Protein Sequence
MGIIDFFMALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Salmonella arizonae UPF0442 protein yjjB and why is it significant for research?

The UPF0442 protein yjjB is a 157-amino acid protein from Salmonella arizonae with the sequence MGIIDFFMALMQDMILSAIPAVGFAMVFNVPHRALP... (full sequence as documented) . Its significance stems from S. arizonae's evolutionary position between human pathogenic Salmonella strains and non-pathogenic varieties. This makes yjjB an ideal model protein for studying evolutionary transitions in bacterial proteins, particularly those that might be associated with adaptation to different hosts . The UPF prefix (UnPredicted Function) indicates that while the protein has been identified and sequenced, its precise biological function remains to be fully characterized, presenting opportunities for novel functional studies.

What are the structural characteristics of the yjjB protein?

The yjjB protein (157 amino acids) appears to have hydrophobic regions suggesting possible membrane association, as indicated by the amino acid sequence containing multiple hydrophobic residues such as phenylalanine, leucine, isoleucine, and valine . The sequence suggests it may form transmembrane helices, though structural studies using X-ray crystallography or cryo-EM would be needed to confirm its three-dimensional configuration. Researchers should note that recombinant versions of this protein may include tags that could influence structural properties, and the exact tag type is typically determined during the production process .

How does the genomic context of yjjB in Salmonella arizonae compare to other Salmonella species?

Salmonella arizonae (strain ATCC BAA-731) has a 4,574,836 bp genome containing 4,203 protein-coding genes, 82 tRNA genes, and 7 rRNA operons . Comparative genomic analysis reveals that S. arizonae shares some features with both S. typhimurium (subgroup I) and S. bongori (subgroup V). Specifically, there are 2,823 genes common to all three genomes, with 926 genes specific to S. arizonae strain RKS2983 . The yjjB gene (locus name SARI_03035) exists within this genomic context. When examining pathogenicity islands, S. arizonae shares SPI-2 with S. typhimurium LT2 (absent in S. bongori), suggesting potential intermediate pathogenicity characteristics that make it valuable for evolutionary studies .

What is the recommended protocol for reconstitution and storage of recombinant yjjB protein?

For optimal reconstitution of lyophilized recombinant yjjB protein:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard in many laboratories)

  • Aliquot for long-term storage at -20°C or -80°C

For storage stability, note that liquid formulations typically maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized preparations can remain stable for up to 12 months under the same conditions . To maintain protein integrity, avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week . These parameters may need optimization depending on your specific experimental applications.

How can researchers detect and validate the presence of Salmonella yjjB protein in experimental samples?

While the search results don't provide specific detection methods for yjjB protein itself, researchers can adapt standard protein detection methodologies:

  • Western Blotting: Using antibodies against the yjjB protein or against tags incorporated in the recombinant version.

  • Mass Spectrometry: For identification and quantification of the protein in complex samples.

  • PCR Detection: Though this detects the gene rather than the protein, researchers can detect yjjB-encoding genes using custom primers designed from the known sequence. As a reference methodology, PCR detection of Salmonella genes (such as invA) can be performed using the following conditions:

    • Pre-denaturation: 95°C for 2 min

    • 35 cycles of: denaturation at 94°C for 1 min, annealing for 1 min, extension at 72°C for 45 sec

    • Final elongation: 72°C for 7 min

    • Analysis by electrophoresis on 1.5% agarose gel stained with ethidium bromide

  • ELISA: Commercial ELISA kits are available for detecting this recombinant protein .

Validation should include positive and negative controls, and multiple detection methods may be necessary for conclusive identification.

What expression systems are recommended for producing recombinant Salmonella arizonae yjjB protein?

  • Including purification tags (His, GST, etc.) to facilitate downstream isolation

  • Codon optimization for the chosen expression system

  • Signal peptides if secretion is desired

  • Appropriate promoter selection for desired expression levels

Expected yield and purity will vary by system, but commercial preparations typically achieve >85% purity as determined by SDS-PAGE . Researchers should perform pilot expressions to optimize conditions for their specific applications.

How might yjjB protein function be elucidated through comparative genomic approaches?

To investigate the function of yjjB through comparative genomics:

This multifaceted approach may reveal whether yjjB contributes to pathogenicity, host adaptation, or more general bacterial physiological processes.

What role might the yjjB protein play in Salmonella pathogenicity and host adaptation?

The evolutionary position of S. arizonae between human pathogenic strains (subgroup I) and typically non-pathogenic varieties (subgroup V/S. bongori) makes yjjB particularly interesting for pathogenicity studies . Research approaches to investigate its role might include:

  • Gene knockout studies: Create yjjB deletion mutants and assess changes in virulence, colonization ability, or stress response.

  • Pathogenicity island analysis: Determine if yjjB is located within or associated with known Salmonella pathogenicity islands (SPIs). The comparative genomic analysis showed that S. arizonae shares SPI-2 with S. typhimurium but not with S. bongori .

  • Infection models: Test wild-type vs. yjjB mutants in appropriate infection models. The experimental approach used for S. diarizonae in lambs could serve as a methodological reference, where tissue samples were collected at intervals following infection and examined for bacterial presence and histopathological changes .

  • Protein interaction studies: Identify binding partners of yjjB that might indicate involvement in specific virulence mechanisms.

  • Expression analysis: Compare yjjB expression levels under conditions mimicking different host environments (temperature, pH, nutrient availability) to assess potential host-specific regulation.

The presence of yjjB in the evolutionary intermediate S. arizonae but not necessarily in all Salmonella species could indicate a role in the transition from environmental to host-adapted lifestyles.

How can researchers distinguish between the effects of native and recombinant yjjB protein in experimental systems?

Distinguishing native from recombinant yjjB effects requires careful experimental design:

  • Tagged vs. untagged comparisons: Develop parallel experiments using tagged recombinant protein alongside untagged versions to identify potential tag artifacts.

  • Concentration considerations: Native yjjB likely exists at specific physiological concentrations, whereas recombinant protein experiments often use higher concentrations. Perform dose-response experiments to identify concentration-dependent artifacts.

  • Post-translational modification analysis: Compare recombinant yjjB (which may lack bacterial-specific modifications) with native protein using mass spectrometry to identify differences.

  • Complementation studies: In yjjB knockout strains, compare complementation with native gene versus recombinant protein addition.

  • Structural validation: Use circular dichroism or other structural techniques to compare native and recombinant protein folding.

  • Activity assays: Once functional assays for yjjB are developed, compare activity of native protein (isolated from S. arizonae) with recombinant versions to validate functional equivalence.

Systematic documentation of these differences will improve interpretation of experimental results and enhance reproducibility across different research groups.

How does yjjB from Salmonella arizonae compare to homologous proteins in other bacterial species?

The UPF0442 family of proteins, to which yjjB belongs, appears across various bacterial species. Comparative analysis between S. arizonae yjjB and homologs like the one in Shigella flexneri (UniProt: Q7UAJ5) can reveal evolutionary insights:

FeatureS. arizonae yjjBS. flexneri yjjBSignificance
Length157 amino acids Partial (length not specified) Potential functional domains may be conserved or variable
Sequence conservationReference sequence Sequence similarity requires alignmentConserved regions likely indicate functional importance
Genomic contextSARI_03035 Not specifiedSynteny may suggest conserved operons
Host rangeIntermediate pathogen Human pathogenCorrelation with pathogenicity
Structural predictionsPotential membrane protein Not specifiedConservation of structural elements

Researchers should perform comprehensive sequence alignments and structural predictions across multiple bacterial species to identify conserved motifs that might indicate functional domains. The evolutionary relationship between S. arizonae and other Salmonella species (with 2,823 genes common to S. arizonae, S. bongori, and S. typhimurium) provides context for understanding yjjB conservation and divergence.

What can we learn from comparing yjjB protein expression patterns across different Salmonella strains and growth conditions?

Comparative expression analysis of yjjB might reveal its regulatory patterns and potential functions:

  • Cross-strain comparison: Analyze yjjB expression in S. arizonae versus S. typhimurium and S. bongori under identical conditions to identify strain-specific regulation.

  • Environmental response: Compare expression under varying temperatures, pH levels, osmolarity, and nutrient availability to identify environmental triggers for expression.

  • Host-mimicking conditions: Measure expression under conditions mimicking different host environments (mammalian body temperature, gut pH, bile presence) versus environmental conditions.

  • Infection stage correlation: If yjjB is involved in pathogenicity, expression may vary during different infection stages (adhesion, invasion, intracellular survival, dissemination).

  • Stress response pattern: Examine expression during various stress conditions (oxidative stress, antimicrobial exposure, nutrient limitation) to identify potential roles in stress adaptation.

A standardized RT-qPCR protocol could be adapted from the PCR methodology used for invA gene detection , with appropriate primers designed specifically for yjjB. RNA-seq approaches would provide more comprehensive comparative expression data across the entire genome.

What novel applications might emerge from further characterization of the yjjB protein?

As researchers elucidate the function and properties of yjjB, several potential applications may emerge:

  • Evolutionary biomarkers: If yjjB proves to be characteristic of the evolutionary transition between non-pathogenic and pathogenic Salmonella, it could serve as a marker for evolutionary studies and potentially for assessing pathogenic potential.

  • Diagnostic targets: If yjjB contains unique epitopes or sequences, these could be developed into diagnostic assays for specific detection of S. arizonae in clinical or environmental samples.

  • Vaccine development: Should yjjB prove immunogenic and surface-exposed, it might represent a target for vaccine development, particularly if it's involved in virulence or host adaptation.

  • Structural biology insights: As an UPF (UnPredicted Function) protein, structural characterization of yjjB may reveal novel protein folds or motifs with broader implications for protein science.

  • Antimicrobial targets: If yjjB proves essential for S. arizonae survival or virulence, it could represent a novel target for antimicrobial development, particularly if it's sufficiently different from host proteins.

The evolutionary significance of S. arizonae as an intermediate between human pathogens and non-pathogens makes yjjB particularly valuable for understanding bacterial adaptation to new hosts .

What are the most significant technical challenges in studying yjjB protein function, and how might they be overcome?

Researchers face several challenges when investigating yjjB:

  • Functional ambiguity: As an UPF protein, its function remains unknown. This challenge can be addressed through:

    • Systematic phenotypic screening of knockout mutants under diverse conditions

    • Protein interaction network mapping

    • Subcellular localization studies

    • Comparative genomics across related species

  • Membrane protein challenges: If yjjB is indeed membrane-associated as the sequence suggests , this presents extraction and purification difficulties. Strategies include:

    • Optimization of detergent types and concentrations

    • Nanodisc or amphipol technologies for membrane protein stabilization

    • Expression of soluble domains separately if applicable

  • Expression optimization: Producing functional recombinant protein may require:

    • Testing multiple expression systems beyond mammalian cells

    • Codon optimization for expression host

    • Signal sequence modifications

    • Fusion with solubility-enhancing tags

  • Structural determination: For membrane proteins, consider:

    • Cryo-EM approaches rather than crystallography

    • NMR for specific domains

    • Computational structure prediction with experimental validation

  • Physiological relevance: Ensuring in vitro findings translate to in vivo function through:

    • Animal infection models similar to those used for S. diarizonae

    • Gene complementation studies

    • In vivo expression analysis

Through methodical addressing of these challenges, researchers can gradually unravel the biological significance of this evolutionarily interesting protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.