Recombinant Salmonella arizonae UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant yihY is produced in E. coli systems, followed by affinity chromatography under denaturing or native conditions. Key details include:

  • Expression: Full-length protein (1-290 aa) with optional His-tag or other tags added during production .

  • Purity: >85% confirmed via SDS-PAGE .

  • Storage: Stable at -20°C to -80°C in Tris-glycerol buffers; repeated freeze-thaw cycles are discouraged .

Vaccine Development

  • Membrane proteins like InvH (a T3SS component in S. Typhimurium) have shown promise as vaccine candidates, eliciting strong IgG responses and conferring protection in murine models .

  • yihY’s structural similarity to other immunogenic membrane proteins suggests potential utility in subunit vaccines or diagnostic tools .

Pathogenicity and Persistence

  • Proteins such as RpoS and YicC in Salmonella regulate stress responses and host persistence . yihY’s membrane localization may analogously contribute to environmental survival or virulence.

Comparative Analysis With Homologs

yihY homologs exist across Salmonella species, with sequence conservation indicating functional importance:

Species/StrainUniProt IDSequence IdentityKey Features
S. arizonae (ATCC BAA-731)A9MIA4100%Full-length, 290 aa
S. agona (SL483)B5EZZ9>95%290 aa, minor residue variations
S. Enteritidis PT4B5QWW1>90%290 aa, conserved hydrophobic domains

Data sourced from .

Unresolved Questions and Future Directions

  • Functional Role: The protein’s exact role in S. arizonae membrane dynamics or pathogenicity requires further study.

  • Immunogenicity: No direct data exist on yihY’s efficacy as an antigen; trials akin to InvH-based vaccines are needed.

  • Structural Biology: High-resolution structures could clarify its interaction with host systems or antimicrobial agents.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
The delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yihY; SARI_03639; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRVLPLLLSWISFWLLYSIVPTTRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0761 membrane protein yihY and why is it significant for research?

UPF0761 membrane protein yihY is a membrane-associated protein that has gained research interest due to its potential applications in recombinant protein systems. The protein can be expressed and purified from various host systems, making it versatile for different experimental applications . Its significance stems from its structural characteristics that make it suitable as a potential antigen carrier in vaccine development strategies. The yihY protein can be incorporated into recombinant live-attenuated Salmonella vaccine (RASV) systems, which have demonstrated efficacy in delivering heterologous antigens directly to immune cells . Understanding this protein's properties is essential for researchers developing novel vaccine strategies or studying membrane protein expression systems.

How does Salmonella arizonae differ from other Salmonella subspecies in research applications?

Salmonella enterica subspecies arizonae presents distinct characteristics that differentiate it from other Salmonella subspecies. It is frequently associated with reptile reservoirs but can cause illness in mammals including humans . From a research perspective, S. arizonae has several unique genomic features that influence its research applications. It contains a monophasic H antigen system with high conservation, showing only 8 phase 1 H antigens identified among 46 investigated serovars . Unlike other subspecies, S. arizonae exclusively possesses SPI-20, which encodes a type VI secretion system maintained across all sampled genomes . The subspecies also features a unique sas operon that appears to be a synapomorphy (shared derived trait) specific to this lineage . These distinguishing characteristics make S. arizonae particularly suitable for specific research applications, especially when targeting unique antigen presentation pathways or studying host-pathogen interactions in reptilian systems.

What expression systems are most effective for producing recombinant UPF0761 membrane protein yihY?

Multiple expression systems can be utilized for the production of recombinant UPF0761 membrane protein yihY, each with distinct advantages depending on research objectives. E. coli and yeast expression systems offer the highest protein yields and shorter production timeframes, making them optimal for applications where large quantities of protein are required and where complex post-translational modifications may not be essential . For applications requiring proper protein folding and biological activity, insect cells with baculovirus or mammalian cell expression systems are recommended despite their lower yields. These eukaryotic systems provide the necessary cellular machinery to execute many of the post-translational modifications essential for correct protein folding and retention of biological activity . The selection of an appropriate expression system should be guided by the specific experimental requirements, balancing considerations of yield, turnaround time, and the need for post-translational modifications.

What experimental design is most appropriate for evaluating recombinant yihY expression across different host systems?

When comparing yihY expression across multiple host systems, a Randomized Block Design (RBD) is most appropriate due to its ability to control for extraneous variables. In this context, each host system (E. coli, yeast, insect cells, and mammalian cells) represents a treatment, while experimental batches or time periods serve as blocks . The RBD approach allows researchers to systematically allocate treatments within homogeneous blocks, reducing error variance by accounting for batch-to-batch variability . The experimental procedure should involve:

  • Forming homogeneous blocks of experimental units (e.g., culture batches prepared simultaneously)

  • Randomly allocating each expression system (treatment) within each block

  • Maintaining consistent growth conditions within blocks

  • Measuring protein yield, purity, and functional activity

This design can be represented mathematically as:
yᵢⱼ ~ N(μ + αᵢ + τⱼ, σ²)

How should researchers determine the optimal sample size for studies evaluating yihY protein expression?

Determining optimal sample size for yihY protein expression studies requires balancing statistical power with resource constraints. When utilizing a Completely Randomized Design (CRD), researchers should consider:

  • The anticipated effect size between different experimental conditions

  • The expected variability within each treatment group

  • The desired statistical power (typically 0.8 or higher)

  • The significance level (conventionally α = 0.05)

The design flexibility of CRD allows for different numbers of replications per treatment . For example, if evaluating four expression conditions with 20 experimental units available, researchers might allocate:

  • 3 replications for the baseline E. coli system

  • 5 replications for yeast expression

  • 6 replications each for more variable insect and mammalian cell systems

What controls are essential in experimental designs evaluating recombinant yihY function?

Robust control implementation is critical for valid interpretation of recombinant yihY functional studies. Essential controls include:

  • Expression vector control: Host cells containing the expression vector without the yihY insert to differentiate effects of the vector from those of the recombinant protein

  • Wild-type protein control: Native, non-recombinant yihY protein to assess whether recombinant forms maintain natural functionality

  • Host system controls: Untransformed host cells to establish baseline cellular responses

  • Positive functional controls: Well-characterized membrane proteins with established expression patterns to validate experimental conditions

  • Negative controls: Related but functionally distinct membrane proteins to confirm specificity of observed effects

When incorporating yihY into Salmonella as a vaccine vector, additional controls are necessary:

  • Attenuated Salmonella without recombinant protein to distinguish vector effects from antigen effects

  • Salmonella expressing an irrelevant recombinant protein to control for non-specific immune responses

Control selection should be systematically documented and consistently applied across experimental replicates to ensure reliable data interpretation.

What attenuation strategies are most effective for developing Salmonella arizonae as a recombinant yihY expression vector?

Developing effective attenuation strategies for S. arizonae as a recombinant yihY expression vector requires consideration of its unique pathogenicity islands and virulence mechanisms. Based on genomic analyses, the most promising approaches include:

  • SPI-2 effector modifications: Since S. arizonae has naturally lost several SPI-2 effectors (sseG and ssaI), strategically modifying remaining effectors can further attenuate virulence while maintaining immunogenicity . This approach preserves the vector's capacity to reach lymphoid tissues while reducing pathogenic potential.

  • Balanced lethal systems: Implementing plasmid vectors with balanced lethal systems ensures stability of the yihY-encoding plasmid post-immunization without antibiotic selection . This system typically involves deletion of an essential gene from the chromosome and complementation via the recombinant plasmid.

  • SPI-20 modifications: Since SPI-20 (encoding a type VI secretion system) is unique to S. arizonae and well-maintained across all genomes, targeted modifications of this island can create stable attenuation without compromising the vector's ability to stimulate immune responses .

The effectiveness of these strategies should be evaluated through in vitro invasion assays, persistence studies in animal models, and comprehensive immune response profiling. Successful attenuation should result in limited systemic spread while maintaining the vector's ability to reach the mesenteric lymph nodes where recombinant protein production occurs most effectively .

How does the genetic background of Salmonella arizonae influence recombinant yihY expression and stability?

The genetic background of S. arizonae significantly impacts recombinant yihY expression through several mechanisms:

  • Prophage content: S. arizonae harbors multiple prophages, including five novel prophages identified through whole-genome sequencing . These genetic elements can influence plasmid stability and recombinant protein expression through mechanisms such as homologous recombination and phage induction. Researchers should characterize the prophage content of their specific strain and consider selecting strains with minimal prophage activity.

  • Plasmid compatibility: The IncFII(S) plasmid replicon is present in approximately 25% of S. arizonae genomes . Recombinant expression vectors must be designed with compatible replicons to avoid plasmid incompatibility issues that could reduce yihY expression stability.

  • Polyphyletic nature: Nearly one-third of S. arizonae serovars are polyphyletic, with some appearing in up to five distinct evolutionary lineages . This genetic diversity means expression systems optimized for one strain may perform differently in another, even within the same serovar. Whole-genome sequencing of working strains is recommended prior to vector development.

When designing expression systems, researchers should consider clade-specific genetic features, as prophage content and fimbrial operons exhibit clade-specific patterns that may influence vaccine vector performance and immunogenicity .

What methodological approaches optimize immunogenicity of recombinant yihY when expressed in Salmonella arizonae vaccine vectors?

Optimizing immunogenicity of recombinant yihY in S. arizonae vaccine vectors requires strategic methodological approaches targeting specific immune activation pathways:

  • SPI-2-regulated expression: Placing yihY under the control of SPI-2-regulated promoters ensures protein production occurs at appropriate timepoints after the vector reaches antigen-presenting cells . This temporal regulation maximizes presentation to MHC class I and II molecules, enhancing T-cell responses.

  • Targeting of Peyer's patch M cells: S. arizonae efficiently targets intestinal sensory cells (M cells) in Peyer's patches, which play a key role in stimulating mucosal immune responses . Enhancing this targeting through fusion with M-cell specific ligands can significantly improve mucosal immunity.

  • Secretion system selection: The choice between cytoplasmic expression, periplasmic secretion, or surface display of yihY significantly impacts immune response profiles. Evidence suggests that secretion via the SPI-2 Type III Secretion System (T3SS) into the cytosol of antigen-presenting cells most effectively stimulates CD8+ T cell responses .

  • Dosage optimization: Vaccine dosage must be empirically determined through dose-response studies. Typically, administration of 10⁸-10⁹ CFU is optimal for mucosal immunization, balancing bacterial load with minimal vaccine shedding .

  • Route selection: Oral administration is generally preferred for stimulating both mucosal and systemic immunity, as it mimics the natural infection route and effectively targets gut-associated lymphoid tissue (GALT) .

Implementation of these methodological approaches requires careful validation through immune profiling, including measurement of antibody titers, cytokine responses, and T-cell activation markers.

How can structural analysis of yihY inform vaccine design strategies using Salmonella arizonae vectors?

Advanced structural analysis of yihY can significantly enhance rational vaccine design using S. arizonae vectors through multiple approaches:

  • Epitope mapping and optimization: Structural determination of yihY through techniques such as X-ray crystallography or cryo-electron microscopy allows identification of surface-exposed epitopes that can be modified or enhanced. These epitopes can then be engineered to present heterologous antigens from pathogens of interest while maintaining proper protein folding .

  • Fusion protein design: Understanding the three-dimensional structure of yihY enables strategic design of fusion proteins that incorporate immunogenic epitopes from target pathogens. These fusion constructs must maintain both structural integrity and functional immunogenicity, requiring precise knowledge of tolerable insertion sites within the yihY structure .

  • Stability engineering: Structural insights can guide the introduction of stabilizing mutations or disulfide bonds that enhance protein stability during expression and delivery. This is particularly important given the challenges of membrane protein expression in bacterial systems and the need for stability during transit through the gastrointestinal tract when used in oral vaccines .

  • Post-translational modification sites: Structural analysis can identify potential glycosylation or phosphorylation sites that may be important for protein function or immunogenicity. When expressing yihY in different host systems, researchers must consider which post-translational modifications are essential and select expression systems accordingly .

Implementation of structure-based approaches requires integration of computational modeling, experimental structural determination, and functional validation through immunological assays to confirm that engineered constructs maintain desired properties.

What molecular mechanisms explain variability in immune responses to recombinant yihY expressed in different Salmonella arizonae strains?

The variability in immune responses to recombinant yihY expressed in different S. arizonae strains can be attributed to several molecular mechanisms:

  • Strain-specific SPI-20 functionality: The exclusive presence of SPI-20 in S. arizonae encodes a type VI secretion system that influences host-pathogen interactions . Variation in SPI-20 gene expression between strains may alter the vector's interaction with host immune cells, affecting antigen presentation and subsequent immune responses.

  • Prophage-encoded immune modulators: The diverse prophage content across S. arizonae strains, including five novel prophages, may encode immune modulatory proteins that influence host responses . These phage-encoded factors can alter inflammation, cytokine production, and antigen presentation pathways in strain-specific patterns.

  • Fimbrial operon diversity: The presence of the sas operon as a synapomorphy for S. arizonae, alongside clade-specific fimbrial patterns, affects adhesion properties and targeting of specific immune cell populations . Strains with different fimbrial profiles may preferentially interact with different subsets of antigen-presenting cells.

  • Polyphyletic effects on antigen processing: The polyphyletic nature of many S. arizonae serovars, with some appearing in up to five distinct evolutionary lineages, creates diversity in core metabolic and immunological properties . These differences can affect persistence in host tissues, recombinant protein expression levels, and ultimately antigen processing and presentation.

To address this variability, researchers should comprehensively characterize candidate vaccine strains through whole-genome sequencing, transcriptomics, and immunological profiling before selecting optimal vectors for specific applications.

How can Latin Square Design enhance evaluation of multiple factors affecting recombinant yihY expression and immunogenicity?

The Latin Square Design (LSD) offers a powerful approach for evaluating multiple factors affecting recombinant yihY expression and immunogenicity while minimizing required experimental units:

A practical example would be evaluating three S. arizonae strains, three expression constructs, and three immunization routes. The LSD would arrange these in a 3×3 grid with each combination appearing once. This approach is particularly valuable for complex vaccine development studies where multiple variables must be optimized simultaneously while maintaining statistical power with limited resources.

What data analysis approaches best address the polyphyletic nature of Salmonella arizonae when evaluating strain-specific effects on yihY expression?

The polyphyletic nature of S. arizonae, with nearly one-third of serovars appearing in multiple distinct evolutionary lineages , presents unique challenges for data analysis. The following approaches are recommended:

  • Phylogenetically aware statistical methods: Standard statistical methods that assume independence between observations are inappropriate when analyzing strains with complex evolutionary relationships. Instead, phylogenetic comparative methods such as phylogenetic generalized least squares (PGLS) or phylogenetic mixed models should be employed to account for shared evolutionary history.

  • Whole-genome based classification: Rather than relying on traditional serotyping, which may group genetically divergent strains together, whole-genome sequencing data should be used to place experimental strains within appropriate phylogenetic contexts . This approach ensures that observed differences in yihY expression are correctly attributed to relevant genetic backgrounds.

  • Multi-level modeling for nested data: When evaluating yihY expression across multiple isolates within polyphyletic serovars, multi-level models can account for the hierarchical structure of the data where isolates are nested within evolutionary lineages. This approach partitions variance appropriately between within-lineage and between-lineage effects.

  • Bayesian approaches for small sample sizes: Given the potentially limited number of strains available from each evolutionary lineage, Bayesian statistical methods offer advantages for robust inference with small sample sizes while incorporating prior knowledge about S. arizonae biology.

Implementation of these approaches requires interdisciplinary collaboration between microbiologists, evolutionary biologists, and biostatisticians to ensure appropriate experimental design and data analysis that accounts for the complex evolutionary history of S. arizonae.

What are the most common challenges in expressing yihY in different host systems and how can they be addressed?

Expression of yihY presents several system-specific challenges that require tailored troubleshooting approaches:

  • E. coli expression systems:

    • Challenge: Membrane protein toxicity and inclusion body formation

    • Solution: Use lower induction temperatures (16-20°C), specialized strains (C41/C43), and fusion tags that enhance solubility (SUMO, MBP)

    • Challenge: Incomplete post-translational modifications

    • Solution: Consider alternative expression systems when native functionality depends on specific modifications

  • Yeast expression systems:

    • Challenge: Hyperglycosylation affecting protein structure

    • Solution: Utilize glycosylation-deficient strains or mutate N-glycosylation sites when glycosylation patterns are critical

    • Challenge: Codon usage bias

    • Solution: Optimize codons for yeast expression while maintaining critical structural elements

  • Insect/Mammalian cell systems:

    • Challenge: Lower yield compared to bacterial systems

    • Solution: Optimize cell density, infection multiplicity (for baculovirus), and harvest timing

    • Challenge: Higher cost and longer production times

    • Solution: Scale processes appropriately and implement efficient purification schemes to maximize recovery of correctly folded protein

Across all systems, inclusion of solubilization tags, careful optimization of induction conditions, and implementation of high-throughput small-scale screening can identify optimal expression parameters before scaling to larger volumes.

How should researchers troubleshoot inconsistent immune responses to recombinant yihY in Salmonella arizonae vaccine studies?

Inconsistent immune responses to recombinant yihY in S. arizonae vaccine studies can be systematically addressed through the following troubleshooting approach:

  • Vector stability assessment:

    • Evaluate plasmid retention in recovered bacteria from immunized subjects

    • Sequence plasmids to detect potential mutations

    • Implement more robust balanced lethal systems if instability is detected

  • Expression level verification:

    • Quantify yihY expression levels in recovered bacteria using RT-qPCR and western blotting

    • Confirm protein folding and presentation using conformation-specific antibodies

    • Adjust promoter strength or codon usage if expression levels are suboptimal

  • Colonization profiling:

    • Monitor bacterial load in lymphoid tissues at multiple timepoints

    • Assess fecal shedding patterns to evaluate gastrointestinal persistence

    • Modify attenuation strategy if colonization is insufficient or excessive

  • Immune response characterization:

    • Comprehensively profile both humoral and cellular immune responses

    • Evaluate both systemic and mucosal compartments

    • Determine if response variability correlates with specific host or bacterial factors

  • Host variability control:

    • Implement more stringent inclusion/exclusion criteria for experimental subjects

    • Consider genetic background effects in animal models

    • Increase sample sizes to account for inherent biological variability

When detecting inconsistencies, researchers should systematically evaluate each step in the vaccine development and testing process to identify the source of variability before adjusting experimental protocols.

What statistical analysis approaches are most appropriate for analyzing complex datasets from yihY expression optimization experiments?

Complex datasets from yihY expression optimization experiments require sophisticated statistical approaches to account for multiple variables and potential interactions:

  • Factorial design analysis:

    • When optimizing multiple expression parameters simultaneously (temperature, induction timing, media composition), factorial analysis allows identification of both main effects and interaction effects

    • Analysis of variance (ANOVA) for balanced designs or mixed-effects models for unbalanced designs should be applied

  • Response surface methodology (RSM):

    • For continuous optimization variables, RSM provides mathematical models describing how response variables (protein yield, activity) change across a range of experimental conditions

    • Enables identification of optimal conditions through statistical modeling rather than exhaustive experimentation

  • Multivariate analysis for multiple response variables:

    • When measuring multiple outcome metrics (expression level, solubility, activity, antigenicity), multivariate approaches like principal component analysis (PCA) or partial least squares (PLS) can identify patterns across outcomes

    • These methods reduce dimensionality while preserving relationships between variables

  • Nested experimental designs:

    • For experiments with hierarchical structure (e.g., technical replicates nested within biological replicates), mixed-effects models appropriately partition variance components

    • These approaches prevent pseudoreplication and inflated Type I error rates

  • Non-parametric alternatives:

    • When data violate normality assumptions, non-parametric alternatives such as Kruskal-Wallis tests followed by appropriate post-hoc comparisons maintain statistical validity

Implementation of these approaches should be guided by experimental design principles, with statistical analysis plans developed before data collection begins to ensure appropriate power and sample size calculations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.