Recombinant Salmonella arizonae Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella arizonae Zinc Transport Protein ZntB (zntB)

The zntB locus of Salmonella enterica serovar Typhimurium encodes a protein involved in zinc transmembrane flux . ZntB is a novel zinc transport system in enteric bacteria . The protein is homologous to the CorA family of magnesium transport proteins and is widely distributed among eubacteria .

Function and Mechanism

ZntB facilitates zinc efflux, helping to maintain intracellular zinc homeostasis . Mutations in zntB result in increased sensitivity to the cytotoxic effects of zinc and cadmium, suggesting that the encoded protein mediates the efflux of both cations . ZntB does not facilitate zinc uptake; instead, it plays a role in zinc efflux .

Role in Salmonella enterica

Salmonella enterica serovar Typhimurium strains are used as antigen delivery vectors to induce systemic and mucosal immunity against recombinant antigens and protect against salmonellosis . Live attenuated Salmonella enterica serovar Typhimurium vaccines are effective in inducing antibody- and cell-mediated immune responses . The high-affinity zinc transporter ZnuABC enables ATP synthesis via substrate-level phosphorylation, sustaining Salmonella growth during the nitrosative stress generated in the host's innate immune response .

Experimental Data

ZntB's transport activity was characterized by measuring the uptake of $$^{65}Zn^{2+}$$ in wild-type Salmonella Typhimurium, zntB mutant, and complementing strains . The zntB mutant accumulated 1.2-fold greater zinc than the wild-type, while expression of zntB reduced zinc accumulation to 1.1-fold of wild-type levels, indicating ZntB does not facilitate zinc uptake, but may have a role in zinc efflux . Introducing a plasmid encoding ZntB into a zinc transport-deficient E. coli strain increased the rate of $$^{65}Zn^{2+}$$ efflux 8.8-fold, demonstrating that ZntB can facilitate zinc efflux .

ZntB and Metal Homeostasis

ZntB is crucial for maintaining zinc homeostasis, protecting cells from zinc toxicity . It works with other zinc transporters, such as ZnuABC, to manage zinc levels within the cell, especially under stress conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
zntB; SARI_01326; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Target Names
zntB
Target Protein Sequence
MEAIKGSEVNVPDAVFAWLLDGRGGVKPLEDDDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERLIVSTR QRKVLALDDVVSDLQEGAGPTDCGGWLVDVCDALTDHASEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIALVMQESLTRRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIAGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

An effective experimental design for studying ZntB transport requires careful consideration of multiple variables:

Experimental Components:

  • Protein Preparation:

    • Express full-length ZntB with a purification tag (typically His-tag)

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Verify protein integrity using SDS-PAGE (>90% purity)

  • Liposome Reconstitution:

    • Use E. coli polar lipids or a defined mixture of phospholipids

    • Control protein:lipid ratio (typically 1:100 to 1:1000 w/w)

    • Ensure uniform proteoliposome size through extrusion

  • Transport Assays:

    • Radioisotope method: Use 65Zn2+ to directly measure uptake/efflux rates

    • Fluorescence-based method: Employ zinc-sensitive fluorophores inside liposomes

    • pH gradient establishment: Use different internal/external buffers or ionophores

Controlled Variables:

  • Temperature (typically 25°C or 37°C)

  • Buffer composition (control for competing ions)

  • pH gradients (internal vs. external)

  • Zinc concentration (typically 1-100 μM range)

  • Time points (0-30 minutes for kinetic analysis)

Data Analysis:

  • Calculate initial rates of transport

  • Determine Km and Vmax values

  • Compare wild-type vs. mutant proteins

  • Assess pH dependence of transport

This approach was successfully employed in the study by the authors of source , who demonstrated that ZntB mediates zinc uptake stimulated by a pH gradient across the membrane.

What structural features distinguish ZntB from other members of the CorA superfamily, and how do these relate to function?

ZntB belongs to the CorA superfamily of metal ion transporters but exhibits distinct structural features that correlate with its zinc transport function:

Key Structural Distinctions:

FeatureZntBCorAFunctional Implication
Symmetry maintenanceMaintains pentameric symmetry even after EDTA treatment Forms asymmetrical state upon Mg2+ depletion Different gating mechanisms
Cytoplasmic domainStrong positive electrostatic potential in EcZntB More negative potential in StZntB isolated domain May relate to ion selectivity
Internal poreDifferent shape between proposed conformational states More consistent pore geometrySuggests distinct transport mechanism
TM1 helixContains patch of conserved basic and acidic residues Different charge distributionMay be involved in Zn2+ coordination

These structural distinctions support the hypothesis that while CorA functions as a channel, ZntB operates as a transporter using a different mechanism . The maintenance of symmetry in ZntB even under metal-depleted conditions suggests a fundamentally different conformational change during the transport cycle.

To experimentally investigate these structural distinctions, researchers can:

  • Generate ZntB point mutations in the TM1 helix to test the role of charged residues

  • Use molecular dynamics simulations to model conformational changes

  • Compare cryo-EM structures under different metal ion and pH conditions

  • Perform crosslinking studies to capture different conformational states

How can researchers address the contradiction between whole-cell and in vitro transport assays for ZntB?

The conflicting results between whole-cell assays suggesting ZntB is an exporter and in vitro studies indicating it functions as an importer present a significant research challenge. Here's a methodological approach to resolve this contradiction:

Comprehensive Experimental Design:

  • Combined Approaches:

    • Perform parallel whole-cell and in vitro assays using identical ZntB constructs

    • Use multiple complementary methods for zinc quantification

    • Include appropriate controls for each system

  • Whole-Cell Experiments:

    • Use ZntB knockout strains complemented with wild-type or mutant ZntB

    • Measure intracellular zinc accumulation using 65Zn2+ radioisotope

    • Monitor growth under varying zinc concentrations (0-100 μM)

    • Assess sensitivity using disk diffusion assays

  • In Vitro Reconstitution:

    • Reconstitute purified ZntB in liposomes with defined orientation

    • Establish pH gradients that mimic physiological conditions

    • Measure zinc transport bidirectionally

    • Use zinc-chelating agents to control free zinc concentrations

  • Advanced Approaches:

    • Develop zinc-sensitive fluorescent biosensors for real-time tracking

    • Employ zinc-specific microelectrodes for direct measurement

    • Use isothermal titration calorimetry to quantify binding thermodynamics

    • Apply site-directed mutagenesis to key residues in the transport pathway

Data Integration Framework:

ParameterWhole-Cell SystemReconstituted SystemIntegration Approach
Direction of transportMeasured by net accumulationDirectly measuredCompare net flux under identical conditions
KineticsComplex due to multiple transportersClean system for direct measurementUse inhibitors to isolate ZntB contribution in cells
pH dependenceChallenging to control preciselyEasily manipulatedCorrelate transport rates with pH gradients
Energy couplingMultiple energy sources availableDefined gradients onlyTest specific gradient requirements in both systems

By systematically addressing these parameters, researchers can develop a unified model that explains the apparent contradictions in ZntB function under different experimental conditions.

What are the optimal expression systems and purification strategies for obtaining functional recombinant ZntB?

Producing high-quality recombinant ZntB protein is critical for structural and functional studies. Based on published research, the following methodological approach has proven successful:

Expression Systems:

SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, simple cultureMay form inclusion bodiesStructural studies requiring large amounts
Cell-freeAvoids toxicity issuesLower yield, expensiveRapid screening of mutants
Insect cellsBetter for membrane proteinsMore complex, expensiveFunctional studies requiring proper folding

Optimized Expression Protocol:

  • Construct Design:

    • Include N-terminal His-tag for purification

    • Consider codon optimization for E. coli expression

    • Use pET-based vectors with T7 promoter for high expression

  • Expression Conditions:

    • Grow E. coli to OD600 of 0.6-0.8 before induction

    • Induce with 0.5 mM IPTG

    • Express at lower temperature (16-20°C) for 16-20 hours to improve folding

    • Add 1 mM ZnCl2 to the growth medium to stabilize the protein

  • Purification Strategy:

    • Solubilize membranes with mild detergents (DDM or LMNG)

    • Perform immobilized metal affinity chromatography (IMAC)

    • Follow with size exclusion chromatography

    • Maintain 5-10% glycerol in all buffers to improve stability

  • Quality Control:

    • Verify >90% purity by SDS-PAGE

    • Confirm zinc binding using isothermal titration calorimetry

    • Assess structural integrity by circular dichroism

    • Validate functionality through transport assays

This approach has been successfully used to produce the recombinant ZntB protein that enabled the cryo-EM structure determination and functional characterization described in the literature .

What are the critical residues in the ZntB transport pathway, and how can they be experimentally validated?

Understanding the key residues involved in ZntB zinc transport is essential for elucidating its mechanism. The following methodological approach can identify and validate these critical residues:

Identification Strategies:

  • Structural Analysis:

    • Analyze cryo-EM structures of ZntB to identify pore-lining residues

    • Focus on conserved charged and polar residues in transmembrane domains

    • Examine the conserved patch of basic and acidic residues on TM1

    • Compare with other CorA superfamily members to identify zinc-specific residues

  • Computational Approaches:

    • Perform molecular dynamics simulations to model zinc passage

    • Calculate electrostatic potentials to identify favorable interaction sites

    • Use bioinformatic analysis to identify conserved residues across ZntB homologs

  • Experimental Validation:

    • Site-directed mutagenesis of candidate residues

    • Functional characterization using transport assays

    • Binding studies using isothermal titration calorimetry

    • Structural studies of mutant proteins

Key Residues and Their Validation:

Based on the available literature, several residues have been implicated in ZntB function:

Residue LocationPotential FunctionExperimental Validation Method
TM1 charged residuesZinc coordination and selectivityAlanine scanning mutagenesis followed by transport assays
Cytoplasmic gate residuesControl of ion accessCrosslinking studies to capture different conformational states
Conserved polar residues in poreZinc coordinationDirect binding assays with purified mutant proteins
Residues at dimer interfacesConformational changes during transportDisulfide crosslinking to assess mobility

A comprehensive mutagenesis study similar to that performed for ZnT2 would be valuable for ZntB, as it could identify residues involved in various aspects of the transport mechanism, including zinc binding, proton coupling, and conformational changes.

How does the evolutionary relationship between ZntB and other metal transporters inform our understanding of metal selectivity?

The evolutionary relationships between ZntB and other metal transporters provide valuable insights into the mechanisms of metal selectivity. A systematic analysis reveals:

Evolutionary Context:

ZntB belongs to the CorA superfamily, traditionally associated with magnesium transport, but has evolved to transport zinc instead . This evolutionary divergence offers an opportunity to understand how metal selectivity has evolved:

  • Phylogenetic Positioning:

    • ZntB proteins form a distinct clade within the CorA superfamily

    • Salmonella arizonae ZntB shares homology with zinc transporters from other bacterial species

    • The evolutionary divergence suggests adaptation to different physiological needs

  • Structural Adaptations for Metal Selectivity:

    • Different electrostatic properties of the cytoplasmic domain between ZntB and CorA

    • Unique amino acid composition in the ion permeation pathway

    • Conservation of specific motifs across zinc-transporting members

Methodological Approach to Study Evolutionary Insights:

ApproachMethodologyExpected Outcome
Comparative genomicsAnalyze ZntB homologs across bacterial speciesIdentification of conserved zinc-specific motifs
Ancestral sequence reconstructionInfer sequences of evolutionary intermediatesUnderstanding of key mutational events that switched selectivity
Domain swapping experimentsCreate chimeric proteins between ZntB and CorADetermination of domains responsible for ion selectivity
Directed evolutionSelect for variants with altered metal specificityEngineering ZntB with novel transport properties

This evolutionary perspective can guide research on the fundamental principles of metal selectivity in transporters and inform the design of experiments to test specific hypotheses about the structural determinants of zinc versus magnesium transport.

What experimental approaches can determine whether ZntB transport is coupled to proton gradients?

The recent finding that ZntB may function as a zinc importer driven by a proton gradient requires rigorous experimental validation. Here's a comprehensive approach to investigate this coupling:

Methodological Framework:

  • Reconstituted System Studies:

    • Prepare ZntB proteoliposomes with defined internal pH

    • Establish various pH gradients (ΔpH) across the membrane

    • Measure zinc transport rates as a function of ΔpH

    • Use pH-sensitive dyes to monitor internal pH changes during transport

  • pH Dependence Analysis:

    • Maintain constant zinc concentration while varying pH gradient

    • Determine stoichiometry of H+/Zn2+ coupling

    • Measure transport at different absolute pH values while maintaining constant ΔpH

  • Inhibitor Studies:

    • Use protonophores (e.g., CCCP) to collapse pH gradients

    • Apply specific inhibitors of ZntB transport

    • Test effects of other gradient-dissipating compounds

  • Mutagenesis Approach:

    • Identify potential proton-binding residues

    • Create point mutations at these sites

    • Assess how mutations affect pH-dependent transport

Experimental Design Table:

ExperimentSetupMeasurementsControls
Basic pH dependenceLiposomes at various internal/external pH65Zn2+ uptake ratesNo gradient condition
Proton flux couplingDouble-labeled liposomes (Zn2+ and H+ indicators)Simultaneous Zn2+ and H+ fluxUncoupled transport systems
Gradient dissipationAdd protonophores at different time pointsEffect on transport ratesNon-dissipating compounds
Kinetic analysisVary [Zn2+] at different ΔpH valuesKm and Vmax changesFixed pH measurements

By applying these approaches, researchers can establish whether ZntB indeed functions as a proton-coupled zinc transporter and characterize the mechanistic details of this coupling.

How can researchers accurately differentiate between Salmonella arizonae subspecies in studies of ZntB function?

Accurate identification and differentiation of Salmonella arizonae is critical when studying ZntB function across Salmonella subspecies. The literature indicates significant taxonomic complexity and identification challenges:

Taxonomy Clarification:

Salmonella arizonae (also called Salmonella enterica subspecies arizonae or Salmonella IIIa) has a complex nomenclature history, having previously been known as Paracolobactrum arizonae and Arizona hinshawii . Proper identification is essential for comparative studies of ZntB function.

Methodological Approach for Accurate Identification:

  • Molecular Identification:

    • 16S rRNA gene sequencing provides 100% identification reliability

    • PCR-restriction fragment length polymorphism analysis using genus-specific primer pairs

    • Flagellin gene-based PCR for Salmonella subspecies determination

  • Biochemical Differentiation:

    • Key differentiating tests include:

      • β-glucuronidase activity (positive in Arizonae)

      • Malonate utilization (positive in most Arizonae strains)

      • H2S production (important diagnostic clue)

      • Lactose fermentation (within 48 hours)

  • Commercial Identification Systems Performance:

SystemAccuracy for S. arizonaeLimitationsRecommendation
ENTERO test 24 N88.24% agreement with genetic studies May misidentify some strainsGood first-line test
Microbact 12eLimited accuracy for subspeciesEffective only for S. arizonae cultureNot recommended for Diarizonae
API 20 ESimilar limitations to Microbact 12eInconsistent subspecies identificationNot recommended alone
  • Confirmation Strategy:

    • Use at least two independent identification methods

    • Confirm subspecies by genetic sequencing when studying ZntB variations

    • Maintain reference strains for comparison

This systematic approach ensures accurate subspecies identification, which is essential when comparing ZntB function across different Salmonella variants, particularly since some strains previously classified as S. arizonae have been reclassified as belonging to Diarizonae subspecies or even Salmonella Bongori .

What experimental design would best elucidate the conformational changes in ZntB during the transport cycle?

Understanding the conformational changes during ZntB transport is crucial for elucidating its mechanism. Based on current knowledge, here's an optimal experimental design approach:

Multi-technique Framework:

  • Cryo-Electron Microscopy:

    • Capture ZntB structures under various conditions:

      • Zinc-bound vs. zinc-free states

      • Different pH conditions to capture proton-coupled conformations

      • In the presence of transport inhibitors

    • Use computational classification to identify distinct conformational states

  • Molecular Dynamics Simulations:

    • Model transitions between observed states

    • Simulate zinc and proton passage through the transport pathway

    • Calculate energy barriers for conformational changes

  • FRET-Based Approaches:

    • Engineer ZntB with fluorophore pairs at strategic positions

    • Monitor distance changes during transport in real-time

    • Correlate FRET changes with transport activity

  • Cross-linking Studies:

    • Introduce cysteine pairs at interfaces predicted to change during transport

    • Apply oxidative cross-linking under different conditions

    • Analyze mobility shifts to identify conformational states

Experimental Conditions Table:

ConditionPurposeExpected Outcome
No zinc, pH 7.4Apo/resting stateBaseline conformation
10 μM Zn2+, pH 7.4Zinc-bound statePotential pre-transport state
pH gradient (5.5 inside, 7.4 outside)Proton-driven transportActive transport conformation
pH gradient + Zn2+Full transport cycleComplete conformational cycle
Cross-linked mutantsRestrict specific movementsIdentify essential conformational changes

This integrated approach would build upon the initial structural insights from the cryo-EM structure of full-length ZntB and help resolve the apparent contradiction between the symmetrical full-length EcZntB structure and the different conformation observed in the soluble domain of StZntB .

How does ZntB contribute to Salmonella virulence, and what experimental models best demonstrate this relationship?

The relationship between zinc homeostasis and bacterial pathogenesis is complex. ZntB's role in Salmonella virulence can be investigated through the following methodological approach:

Experimental Models:

  • Cellular Infection Models:

    • Macrophage infection assays with wild-type vs. zntB mutant Salmonella

    • Measurement of intracellular survival and replication

    • Quantification of zinc levels within infected cells and bacteria

  • Animal Models:

    • Mouse infection models comparing wild-type and ΔzntB strains

    • Colonization assessment in various tissues

    • Survival curves and bacterial burden quantification

  • Zinc Restriction Models:

    • Simulation of host nutritional immunity by zinc chelation

    • Comparative growth of wild-type vs. mutant under zinc limitation

    • Competition assays between strains under various zinc conditions

  • Virulence Gene Expression Analysis:

    • RNA-seq comparing wild-type and ΔzntB strains during infection

    • Quantification of virulence factor expression

    • Correlation of zinc levels with virulence gene expression

Mechanistic Investigations:

AspectMethodologyExpected Outcome
Zinc sensingReporter gene assays for zinc-responsive promotersUnderstanding of regulatory networks
Zinc competitionGrowth in presence of other metal transportersRole in metal selectivity during infection
Host responseCytokine analysis in infection modelsImpact on inflammatory response
Genetic contextAnalysis of genomic location relative to virulence islandsEvolutionary relationship to pathogenicity

While the search results don't directly address ZntB's role in virulence, they do indicate that in Enterobacteriaceae, membrane transporters involved in zinc homeostasis are linked to virulence . The discovery that ZntB is likely a zinc importer suggests it may play a role in zinc acquisition during infection, particularly in zinc-limited host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.