Recombinant Salmonella choleraesuis 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Expression

  • Gene Origin: The ubiA gene is derived from Salmonella choleraesuis (strain SC-B67) and encodes a 290-amino acid protein with a predicted molecular weight of ~33 kDa .

  • Expression System: Recombinant UbiA is typically produced in Escherichia coli with an N-terminal or C-terminal His-tag for purification .

  • Structural Features: UbiA belongs to the UbiA prenyltransferase family, characterized by conserved domains for substrate binding and catalysis. The enzyme’s active site facilitates the transfer of the octaprenyl group from octaprenyl diphosphate to 4-HB .

Table 2: Key Research Findings

Study FocusOutcomeSource
Q8 BiosynthesisubiA mutants lack Q8 under aerobic conditions, impairing respiration
Flagellar AssemblyubiA mutations reduce flagella via disrupted quinone pools
VirulenceQ8-deficient Salmonella shows attenuated macrophage proliferation

Future Directions

  • Structural Resolution: High-resolution crystallography of UbiA could reveal mechanistic insights into prenyltransferase catalysis.

  • Therapeutic Targeting: Inhibitors of UbiA may serve as novel antibiotics, leveraging its essential role in bacterial respiration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ubiA; SCH_4113; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGGGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis, which involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: sec:SCH_4113

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its role in Salmonella choleraesuis?

4-hydroxybenzoate octaprenyltransferase (ubiA) is an essential enzyme in the ubiquinone biosynthetic pathway with EC classification 2.5.1.-. In Salmonella choleraesuis, ubiA catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate, a critical step in ubiquinone (coenzyme Q) synthesis. The gene is identified as SCH_4113 in the Salmonella choleraesuis (strain SC-B67) genome . Ubiquinone functions as an electron carrier in the respiratory chain and contributes significantly to membrane stability and integrity in gram-negative bacteria . Disruption of the ubiquinone pathway has been shown to affect cell envelope stability, making ubiA an important target for both basic bacterial physiology research and potential therapeutic applications .

What are the recommended methods for expressing and purifying recombinant Salmonella choleraesuis ubiA for in vitro studies?

The expression and purification of recombinant Salmonella choleraesuis ubiA requires specialized approaches due to its highly hydrophobic nature and multiple transmembrane domains. A methodological workflow includes:

  • Vector selection: pET-based expression systems with fusion tags (His6, MBP, or SUMO) to enhance solubility.

  • Host selection: E. coli strains optimized for membrane protein expression such as C41(DE3) or C43(DE3).

  • Culture conditions: Growth at lower temperatures (16-20°C) after induction to slow production and improve folding.

  • Membrane extraction: Using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS.

  • Purification strategy: Ni-NTA affinity chromatography followed by size exclusion chromatography.

For stability, purified protein should be maintained in a buffer containing Tris (pH 7.5-8.0), 50% glycerol, and appropriate detergent . When designing activity assays, it's critical to include the substrate 4-hydroxybenzoate and prenyl donors in the presence of Mg2+ ions, as these are required cofactors for catalytic activity.

How can researchers effectively design experiments to study the relationship between ubiA function and bacterial membrane integrity?

When investigating the relationship between ubiA function and bacterial membrane integrity, researchers should implement a multi-parameter experimental design approach:

Table 1: Recommended Experimental Design Parameters for ubiA-Membrane Integrity Studies

Experimental ApproachVariables to ControlMeasurementsStatistical Design
Gene knockout studiesGrowth media, temperature, growth phaseMembrane permeability, lipid composition, cell morphologyRandomized complete block design with 3+ biological replicates
Complementation assaysPlasmid copy number, promoter strengthRestoration of phenotype, growth kineticsBefore-After Control-Impact (BACI) design
Point mutationsMutation position, amino acid substitutionsEnzyme activity, membrane fluidityFactorial design with multiple mutation combinations
Chemical inhibitionInhibitor concentration, exposure timeDose-response relationship, membrane disruptionResponse surface methodology

Control experiments should include: wild-type strains, complemented mutants, and appropriate vector-only controls . To avoid pseudoreplication issues, ensure independent biological replicates are used rather than technical replicates of the same bacterial culture . When analyzing membrane integrity, combine multiple assessment methods such as fluorescent dye uptake assays (propidium iodide), membrane potential measurements (DiOC2), and electron microscopy to obtain comprehensive data on membrane phenotypes .

How does ubiA function coordinate with the aromatic amino acid biosynthesis pathway in Salmonella, and what are the implications for bacterial attenuation strategies?

The coordination between ubiA function and the aromatic amino acid biosynthesis pathway represents a complex metabolic intersection in Salmonella. Both pathways originate from the shikimate pathway, with chorismate serving as a common precursor. This metabolic relationship has significant implications for bacterial attenuation strategies:

  • Metabolic crosstalk: Deletion of aroA, a key enzyme in the aromatic amino acid pathway, influences ubiquinone synthesis by altering chorismate availability for the ubiA-catalyzed reaction . This creates a cascade effect on electron transport chain function.

  • Membrane consequences: Studies have demonstrated that disruption of aroA affects bacterial membrane composition in ways similar to direct ubiquinone pathway disruption. The ΔaroA strains show increased sensitivity to membrane-disrupting agents like EDTA, suggesting altered membrane properties .

  • Virulence modulation: Interestingly, aroA-deficient Salmonella strains exhibit increased immunogenicity despite their metabolic attenuation. Research shows these strains trigger elevated TNF-α production compared to wild-type strains, making them potentially valuable for vaccine development .

  • Flagellar expression effects: The interconnection between these pathways extends to motility, with ΔaroA mutants displaying significantly reduced motility without visible structural changes to flagella under electron microscopy .

For researchers pursuing bacterial attenuation strategies, these metabolic connections suggest that targeting aroA may produce more complex phenotypic changes than simple auxotrophy, potentially enhancing vaccine efficacy through increased immunostimulatory capacity while maintaining safety through metabolic attenuation.

What methodological approaches can be used to investigate the effects of ubiA mutations on Salmonella pathogenesis and vaccine potential?

Investigating the effects of ubiA mutations on Salmonella pathogenesis and vaccine potential requires sophisticated methodological approaches that address both bacterial physiology and host responses:

Table 2: Methodological Framework for ubiA Mutation Studies in Vaccine Development

Research PhaseMethodological ApproachKey MeasurementsAdvanced Analytical Methods
Gene EditingCRISPR-Cas9 or lambda Red recombination for precise ubiA mutationsConfirmation by sequencing, protein expression levelsRT-qPCR, Western blot with anti-ubiA antibodies
Physiological CharacterizationGrowth curves in minimal vs. rich media, stress response profilingDoubling time, survival rates under oxidative stressFlow cytometry for single-cell analysis, metabolomics
Membrane AnalysisLipid profiling, ubiquinone quantificationPhospholipid composition, ubiquinone:menaquinone ratioLC-MS/MS, membrane fluidity assays
Immunogenicity AssessmentIn vitro macrophage stimulation, in vivo immune responseCytokine profiles (TNF-α, IL-12, IFN-γ), antibody titersMultiplex cytokine assays, flow cytometry
Vaccine EfficacyChallenge studies with virulent strainsSurvival rates, bacterial clearance, protective immunityBacterial burden quantification, histopathology

When designing these experiments, controls should include: (1) wild-type strains, (2) complemented mutants, (3) other ubiquinone pathway mutants (ubiG), and (4) established attenuated vaccine strains like aroA mutants for comparison . A randomized block design should be implemented to minimize experimental variability .

For in vivo studies, the immunization protocol should follow established parameters of successful recombinant Salmonella vaccines, such as those demonstrated in the bivalent Salmonella Typhimurium vaccine expressing Choleraesuis O-antigens. This includes a prime-boost strategy with two immunizations at 4-week intervals, followed by challenge with virulent strains at least one month after the second immunization . Both humoral (serum IgG, fecal IgA) and cell-mediated immune responses should be measured, with specific emphasis on the bactericidal activity of vaccine-induced antibodies .

What are the common challenges in expressing functional recombinant ubiA, and how can researchers overcome them?

Researchers frequently encounter several technical challenges when expressing functional recombinant ubiA:

  • Low expression yields: Being a membrane protein with multiple transmembrane domains, ubiA often expresses poorly in conventional systems. To overcome this, employ specialized expression hosts like C43(DE3) specifically designed for membrane proteins, and consider fusion with solubility-enhancing tags like MBP or SUMO. Reducing induction temperature to 16-20°C and extending expression time to 16-20 hours can significantly improve yields.

  • Protein misfolding: Improper folding in the membrane is common with recombinant ubiA. This can be addressed by co-expressing molecular chaperones (GroEL/GroES) and adding glycerol (5-10%) to the culture medium to stabilize membrane proteins during expression.

  • Loss of activity during purification: The catalytic activity of ubiA is highly sensitive to detergent choice during extraction. Screen multiple detergents at their critical micelle concentrations (CMCs), starting with milder options like DDM, CHAPS, or digitonin. Incorporate substrate analogs or inhibitors during purification to stabilize the active site conformation.

  • Heterogeneous product: Purified ubiA often contains truncated forms due to proteolytic degradation. Add protease inhibitors immediately after cell lysis and minimize the time between cell disruption and purification. Consider using strains deficient in specific proteases (e.g., BL21(DE3) pLysS).

  • Storage stability issues: Purified ubiA loses activity rapidly during storage. Stabilize the enzyme by storing in 50% glycerol at -20°C rather than -80°C to prevent freeze-thaw damage to membrane structure . For long-term studies, consider reconstituting the purified protein into liposomes or nanodiscs to maintain a native-like membrane environment.

How can researchers address data inconsistencies and variability when measuring ubiA enzyme activity in different experimental systems?

Addressing data inconsistencies and variability in ubiA enzyme activity measurements requires systematic approaches to experimental design and analysis:

  • Standardize assay conditions: Enzyme activity is highly dependent on temperature, pH, ionic strength, and detergent concentration. Establish a standardized assay protocol with tight control of these parameters. For ubiA specifically, maintaining Mg2+ concentration at 5-10 mM is critical as it's an essential cofactor for activity.

  • Implement robust controls: Include positive controls (commercial prenyltransferases with known activity), negative controls (heat-inactivated enzyme), and internal standards to normalize between experimental batches. Consider using a reference substrate with well-characterized kinetics for cross-experiment calibration.

  • Apply statistical design principles: Use randomized block designs or Latin square designs to control for systematic variations in laboratory conditions or reagent batches . This approach minimizes the impact of variables like day-to-day variation, different protein preparations, or equipment differences.

  • Quantify and account for sources of variation: Conduct a variance components analysis to identify the primary sources of experimental variability. This statistical approach partitions observed variance into components attributable to different experimental factors:

Table 3: Example Variance Components Analysis for ubiA Activity Assays

Source of VariationPercent of Total VarianceMitigation Strategy
Protein preparation42%Standardize purification protocol, pool preps when possible
Substrate batch28%Use single batch for complete series, validate new batches
Instrument calibration15%Perform regular calibration, use internal standards
Operator technique10%Develop detailed SOP, minimize number of operators
Residual/unknown5%Increase replication to reduce impact
  • Avoid pseudoreplication: Ensure truly independent biological replicates rather than technical replicates of the same sample to prevent underestimation of variance .

  • Data transformation and outlier analysis: Apply appropriate statistical transformations for enzyme kinetic data that often doesn't follow normal distribution. Use robust statistical methods like median-based analysis rather than means when outliers are present.

  • Cross-validation between methodologies: When possible, measure activity using multiple orthogonal methods (radioactive assays, HPLC-based detection, coupled enzyme assays) to verify consistency of results across different detection platforms.

How can comparative analysis of ubiA orthologs across Salmonella serovars inform vaccine development strategies?

Comparative analysis of ubiA orthologs across Salmonella serovars can significantly advance vaccine development strategies by revealing conserved epitopes, functional variations, and potential cross-protection opportunities:

  • Epitope conservation analysis: Sequence alignment of ubiA proteins from multiple Salmonella serovars (Typhimurium, Choleraesuis, Enteritidis, Typhi) reveals conservation patterns that may identify ideal targets for broad-spectrum vaccine development. Highly conserved regions that are essential for enzymatic function may serve as universal epitopes for cross-serovar protection.

  • Structure-function relationship: Minor variations in ubiA sequences between serovars may translate to differences in enzyme kinetics, substrate specificity, or membrane integration. These functional differences potentially explain serovar-specific pathogenicity patterns and can guide rational vaccine design targeting specific disease manifestations.

  • Host-adaptation signatures: Comparison of ubiA sequences from host-adapted serovars (like S. Choleraesuis) with broad-host range serovars can identify adaptive mutations that contribute to host specificity. This information helps in developing host-specific vaccine formulations with optimized efficacy.

  • Integration with heterologous antigen expression systems: Research on recombinant Salmonella vaccines demonstrates that properly attenuated strains can effectively express heterologous antigens while maintaining immunogenicity . The attenuation strategy must be carefully balanced with the strain's ability to induce protective immunity. Comparative analysis of ubiA functionality across serovars provides insights into optimal attenuation approaches that preserve immunostimulatory properties.

  • Metabolic impact assessment: Variations in ubiA across serovars may affect the cellular responses to metabolic attenuation strategies. For instance, the interconnection between aroA deletion and ubiquinone pathway suggests that the same genetic modification might produce varying phenotypic outcomes in different serovars . Understanding these serovar-specific responses enables tailored attenuation strategies.

For researchers pursuing this comparative approach, a systematic workflow involving sequence analysis, structural modeling, functional characterization, and in vivo immunogenicity testing of representative ubiA variants is recommended to translate comparative findings into practical vaccine development insights.

What novel experimental designs can be used to investigate the role of ubiA in bacterial survival under vaccine-relevant stress conditions?

Investigating ubiA's role in bacterial survival under vaccine-relevant stress conditions requires innovative experimental designs that simulate in vivo environments while allowing precise measurement of molecular responses:

  • Microfluidic stress gradient chambers: Design and implement microfluidic devices that create controlled gradients of relevant stressors (oxidative stress, pH variation, antimicrobial peptides) while allowing real-time microscopic observation of bacterial responses. This approach permits single-cell analysis of ubiA mutant vs. wild-type strains under precisely defined stress conditions.

  • In vitro granuloma models: Develop three-dimensional cell culture systems mimicking granuloma formation to study ubiA's role in persistent infection. This model incorporates primary human immune cells arranged in layers to simulate the microenvironments bacteria encounter during infection.

  • Dynamic nutrient shift experiments: Implement a randomized block design with split-unit arrangement to study how ubiA-modified strains respond to rapid transitions between nutrient-rich and nutrient-poor environments, simulating conditions bacteria face during vaccination and subsequent infection:

Table 4: Dynamic Nutrient Shift Experimental Design

Main Plot Treatment (Strain)Sub-plot Treatment (Nutrient Condition)Response Variables
Wild-typeRich → PoorGrowth rate, membrane integrity, respiratory activity
ΔubiARich → PoorGrowth rate, membrane integrity, respiratory activity
ubiA point mutantRich → PoorGrowth rate, membrane integrity, respiratory activity
Complemented ΔubiARich → PoorGrowth rate, membrane integrity, respiratory activity
Wild-typePoor → RichGrowth rate, membrane integrity, respiratory activity
ΔubiAPoor → RichGrowth rate, membrane integrity, respiratory activity
ubiA point mutantPoor → RichGrowth rate, membrane integrity, respiratory activity
Complemented ΔubiAPoor → RichGrowth rate, membrane integrity, respiratory activity
  • Ex vivo tissue-associated biofilm model: Develop an ex vivo model using intestinal epithelial tissue to study how ubiA affects biofilm formation and persistence on host tissues, a critical factor in vaccine colonization and immunity development.

  • Repeated measures host-mimicking stress design: Implement a repeated measures experimental design that subjects bacteria to sequential stressors mimicking those encountered during host infection (acid stress → oxidative burst → nutrient limitation → antimicrobial peptides). This design allows evaluation of how ubiA affects adaptive responses to multiple sequential stressors.

  • Before-After Control-Impact (BACI) design for immune system interaction: Apply BACI experimental design to study how ubiA-modified strains interact with immune components before and after exposure to specific immune factors. This approach helps isolate the specific effects of ubiA modification on immune evasion or recognition.

  • Combinatorial stress array: Develop a factorial design testing multiple stressors in combination (temperature, pH, oxidative stress, osmotic stress) to identify potential interaction effects that may only be apparent when multiple stresses are applied simultaneously, better reflecting in vivo conditions.

These advanced experimental designs move beyond simple growth curves or survival assays to provide mechanistic insights into how ubiA contributes to bacterial fitness under conditions relevant to vaccine delivery and efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.