Recombinant Salmonella choleraesuis Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella choleraesuis Cardiolipin Synthase (Cls)

Cardiolipin (CL) synthase (Cls) is an enzyme crucial for synthesizing cardiolipin, an anionic phospholipid primarily located in the energy-transducing membranes of bacteria and the mitochondria of eukaryotes . In Escherichia coli, three Cls enzymes, ClsA, ClsB, and ClsC, catalyze the formation of CL from two phosphatidylglycerol (PG) molecules . Recombinant Salmonella choleraesuis Cls refers to the Cls enzyme produced using recombinant DNA technology in Salmonella choleraesuis, a Gram-negative bacterium .

The Role of Cardiolipin Synthase

CL is essential for various cellular functions, including the optimal activity of enzymes involved in mitochondrial energy metabolism . It stabilizes respiratory complexes, promotes the assembly of adenosine 5'-triphosphate synthase dimers, and maintains the curvature of mitochondrial cristae . In bacteria, CL is involved in cell division and DNA replication .

Discovery of ClsC in E. coli

The E. coli genome encodes three cardiolipin synthases: ClsA, ClsB, and ClsC . A triple mutant lacking all three (clsA, clsB, and clsC) does not produce detectable CL, confirming that ClsC is essential for CL synthesis .

Characteristics of ClsC

ClsC exhibits sequence homology to ClsA and ClsB and belongs to the phospholipase D superfamily . Unlike eukaryotic Cls enzymes, which use PG and CDP-diacylglycerol as substrates, ClsC, in conjunction with YmdB, utilizes phosphatidylethanolamine (PE) as the phosphatidyl donor to PG, representing a unique mode of CL synthesis .

The YmdB-ClsC Complex

ClsC functions in complex with YmdB, a protein containing a macro domain with ADP-ribose-binding potential . Co-expression of both proteins results in CL levels comparable to those achieved by ClsA or ClsB individually . YmdB enhances ClsC activity, and both genes are transcribed from the same polycistronic operon .

Bacterial Species Containing ymdB-clsC Operon

The ymdB-clsC operon is present in bacteria closely related to E. coli, such as Salmonella, Shigella, Cronobacter, Citrobacter, and Enterobacter .

Functional Specificity of Cardiolipin Synthase

Cardiolipin Synthase (CLS) and Phosphatidylglycerophosphate synthase (PGPS), which are involved in the biosynthesis of CL and PG, belong to CDP-alcohol phosphotransferase family .

Recombinant Attenuated Salmonella choleraesuis Vaccines

Recombinant attenuated Salmonella strains are used as live vector vaccines . For example, a recombinant attenuated S. Choleraesuis strain, rSC0016, expressing the PlpE antigen of P. multocida, has been developed as a vaccine candidate . Oral inoculation of rSC0016(pS-PlpE) induces humoral, Th1, Th2, and mucosal immune responses in mice .

Construction of Recombinant S. Choleraesuis Vaccine Strains

Recombinant S. Choleraesuis vaccine strains can be constructed to express various antigens, such as P42 or P97 from Mycoplasma hyopneumoniae . The expression of these antigens is confirmed by PCR amplification and double digestion of the host plasmid .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SCH_1735; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: sec:SCH_1735

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) and what role does it play in bacterial physiology?

Cardiolipin synthase (cls) is an enzyme responsible for synthesizing cardiolipin, an anionic phospholipid crucial for bacterial membrane integrity. In most bacteria, cardiolipin synthase catalyzes the condensation of two phosphatidylglycerol (PG) molecules to form cardiolipin (CL) . The presence of cardiolipin in bacterial membranes plays several critical roles:

  • Supports protein translocation across the inner membrane

  • Contributes to bacterial adaptation during environmental stress responses

  • Affects biofilm formation and bacterial motility

  • Influences cellular division processes

  • Maintains membrane integrity and fluidity

In Salmonella and related enterobacteria, cardiolipin typically comprises 7-10% of total membrane phospholipids, with levels increasing during stationary growth phase .

How is the cls gene organized in Salmonella compared to other enterobacteria?

The cls gene organization in Salmonella follows a pattern similar to other Gram-negative enterobacteria like E. coli and Shigella:

  • Most enterobacteria contain multiple CLS genes, with most species encoding at least 2 synthases

  • The primary cardiolipin synthase in Salmonella is encoded by the clsA gene (also simply designated cls in some literature)

  • Based on studies in related bacteria, Salmonella likely possesses homologs to E. coli's clsB and clsC genes, which provide complementary or conditional cardiolipin synthesis activity

  • ClsA is typically the major cardiolipin synthase during exponential growth, while ClsC contributes significantly during stationary phase

Research in S. flexneri has demonstrated that clsA deletion results in almost complete loss of cardiolipin during exponential growth, confirming its role as the primary synthase .

What are the structural characteristics of Salmonella choleraesuis Cardiolipin synthase?

Based on the available sequence data and structural analysis of homologous proteins:

  • Full-length Salmonella choleraesuis cardiolipin synthase consists of 486 amino acids

  • The protein contains N-terminal transmembrane helical regions that anchor it to the inner membrane

  • The catalytic region includes two phospholipase D-like domains (PLD1 and PLD2)

  • His217 is likely the putative active-site nucleophile, based on homology to other cardiolipin synthases

  • The protein has multiple functional regions including:

    • N-terminal transmembrane helices

    • A short linker region joining the transmembrane region to the catalytic domain

    • The catalytic region containing both PLD domains

The amino acid sequence of Salmonella choleraesuis cardiolipin synthase shows high conservation with other enterobacterial cls proteins, particularly those from S. typhimurium and S. heidelberg (>95% identity) .

What methods are used for expression and purification of recombinant Salmonella cls?

Expression and purification of recombinant Salmonella cls typically follows this methodology:

  • Expression system: E. coli is the preferred heterologous expression host

  • Fusion tags: N-terminal His-tags are commonly used to facilitate purification

  • Storage buffer: Tris/PBS-based buffer with 50% glycerol at pH 8.0 is optimal for stability

  • Storage conditions: -20°C or -80°C for extended storage, with aliquoting to avoid freeze-thaw cycles

  • Working conditions: Stored aliquots can be maintained at 4°C for up to one week

  • Reconstitution: Protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

Biochemical characterization of cardiolipin synthases has historically been challenging due to difficulties in producing sufficient amounts of active, purified protein. Recent advances have improved purification strategies for enterobacterial cls enzymes .

How do mutations in cardiolipin synthase affect bacterial membrane composition and function?

Mutations in cardiolipin synthase can significantly alter membrane phospholipid composition with cascading effects on bacterial physiology:

  • Phospholipid balance: Deletion of clsA increases phosphatidylglycerol (PG) levels while decreasing cardiolipin content

  • Protein translocation: Reduced cardiolipin impairs translocation of proteins across the inner membrane

  • Stress responses: Cardiolipin depletion activates the Rcs envelope stress response pathway

  • Motility impacts: Reduced cardiolipin leads to cells lacking assembled flagella, affecting motility and surface attachment

  • Biofilm formation: Cardiolipin deficiency impairs the earliest stages of biofilm formation, particularly initial attachment

  • Virulence effects: In S. flexneri, cardiolipin synthesis is required for effective plaque formation, with clsA mutants forming only pinpoint plaques

Interestingly, some mutations in cardiolipin synthase, particularly those near the active site (e.g., H215R and R218Q in Enterococcus), can increase enzyme activity and are associated with antimicrobial resistance .

What methodologies are most effective for assessing cardiolipin synthase activity?

Several complementary approaches can be used to assess cardiolipin synthase activity:

Phospholipid Composition Analysis:

  • Bligh-Dyer phospholipid extraction followed by thin-layer chromatography (TLC)

  • Quantification of relative phospholipid proportions (PE:PG:CL ratios)

Genetic Manipulation Approaches:

  • Construction of cls gene deletion mutants (single and combinatorial deletions)

  • Complementation studies with plasmid-expressed cls genes

  • Site-directed mutagenesis of key residues in the catalytic domain

Functional Assays:

  • Plaque formation assays to assess effects on virulence and cell-to-cell spread

  • Protein translocation efficiency measurements

  • Biofilm formation quantification

Biochemical Characterization:

  • In vitro enzyme activity assays using purified recombinant cls proteins

  • Analysis of enzyme kinetics with various substrates

How does cardiolipin distribution differ between bacterial inner and outer membranes?

Cardiolipin shows distinct distribution patterns between bacterial membrane compartments with specific functional implications:

  • Synthesis location: Cardiolipin is synthesized at the inner membrane where cardiolipin synthase is anchored

  • Transport mechanism: Transport of cardiolipin to the outer membrane requires the PbgA (YejM) phospholipid transporter

  • Inner membrane functions: In the inner membrane, cardiolipin:

    • Facilitates protein translocation

    • Supports cell division processes

    • Contributes to energy metabolism by interacting with respiratory complexes

  • Outer membrane functions: In the outer membrane, cardiolipin:

    • Is required for proper surface localization of virulence factors

    • Contributes to membrane integrity and selective permeability

    • May influence interactions with host cells

Research in S. flexneri demonstrates that both cardiolipin synthesis (via ClsA) and transport to the outer membrane (via PbgA) are essential for virulence, with pbgA mutants being unable to form plaques .

What is the relationship between cardiolipin synthesis and antibiotic resistance?

Alterations in cardiolipin synthesis can significantly impact antibiotic susceptibility:

  • Daptomycin resistance: In enterococci, mutations in cardiolipin synthase (particularly in the catalytic region) are associated with daptomycin resistance

  • Increased enzyme activity: Some resistance-associated mutations (H215R, R218Q) increase cardiolipin synthase activity rather than decrease it

  • Membrane charge: Changes in cardiolipin content alter membrane surface charge, potentially affecting interactions with cationic antimicrobial peptides

  • Membrane fluidity: Altered cardiolipin levels modify membrane fluidity and permeability, potentially reducing antibiotic penetration

  • Bacterial stress responses: Cardiolipin-mediated changes in envelope stress responses may upregulate additional resistance mechanisms

These findings suggest that cardiolipin synthase could be both a resistance determinant and a potential drug target .

How do environmental stressors regulate cardiolipin synthesis?

Environmental conditions significantly influence cardiolipin synthesis through multiple regulatory mechanisms:

  • Osmotic stress response: Osmotic stress induces 2-3 fold increases in cls transcription in both E. coli and B. subtilis

  • Growth phase regulation: Cardiolipin levels increase from ~7% in exponential phase to ~10% in stationary phase in S. flexneri

  • Differential synthase expression: While ClsA is the primary synthase during exponential growth, ClsC becomes more active during stationary phase in S. flexneri

  • Intracellular environment effects: Both clsB and clsC show approximately 10-fold induction in intracellular bacteria

  • Transcriptional control: Growth phase transitions trigger transcriptional changes, with cls expression increasing 2.5-fold as E. coli enters stationary phase even in low osmolality media

These regulatory mechanisms allow bacteria to adapt their membrane composition in response to changing environmental conditions, potentially enhancing survival under stress.

What experimental approaches can distinguish between functions of different cardiolipin synthase homologs?

To differentiate the roles of multiple cardiolipin synthase homologs, researchers can employ these strategies:

Genetic Approaches:

  • Generation of single, double, and triple cls gene deletion mutants

  • Growth phase-specific phenotypic analysis of different mutants

  • Complementation studies with plasmid-expressed individual cls genes

Expression Analysis:

  • Quantification of cls gene expression under different growth conditions

  • Measurement of cls gene induction during environmental stress

  • Determination of intracellular expression levels of different cls genes

Biochemical Characterization:

  • Comparison of substrate preferences between different purified cls enzymes

  • Analysis of enzyme kinetics under various physiological conditions

  • Structural studies to identify unique features of each homolog

Phenotypic Assessment:

  • Phospholipid composition analysis of single and combinatorial mutants

  • Virulence assays to determine the contribution of each synthase to pathogenesis

  • Stress response evaluations to identify condition-specific roles

What is the impact of cardiolipin deficiency on bacterial stress response pathways?

Cardiolipin deficiency triggers specific stress response pathways with widespread physiological consequences:

  • Rcs pathway activation: Reduced cardiolipin activates the Regulation of Colanic Acid Synthesis (Rcs) envelope stress response

  • RcsF signaling: Cardiolipin depletion likely activates Rcs through the outer membrane lipoprotein RcsF

  • Mechanistic basis: Impaired protein translocation across the inner membrane appears to be the molecular trigger connecting cardiolipin deficiency to Rcs activation

  • Flagellar repression: Activated Rcs pathway represses flagellar production, disrupting motility and initial biofilm attachment

  • Colanic acid production: Rcs activation triggers production of colanic acid, altering surface properties

  • Biofilm formation: The combined effects lead to significant reductions in biofilm growth and development

This cascade demonstrates how alterations in membrane phospholipid composition can trigger specific stress responses that alter multiple aspects of bacterial physiology and adaptation.

What challenges exist in developing high-throughput screening assays for cardiolipin synthase inhibitors?

Several technical challenges complicate the development of high-throughput screening for cardiolipin synthase inhibitors:

  • Protein stability: Difficulties in producing stable, highly purified cardiolipin synthase for in vitro assays

  • Membrane association: The transmembrane domains of cls proteins complicate expression and purification strategies

  • Assay design: Developing sensitive, reliable assays for cardiolipin formation that are amenable to high-throughput formats

  • Substrate delivery: Ensuring proper presentation of lipid substrates to the enzyme in screening assays

  • Specificity determination: Differentiating between direct enzyme inhibition and non-specific membrane disruption

  • Penetration barriers: Ensuring potential inhibitors can cross bacterial membranes to reach their target

  • Species selectivity: Developing compounds that target bacterial cls without affecting eukaryotic cardiolipin synthesis

Despite these challenges, the importance of cardiolipin in bacterial physiology and virulence makes cls an attractive potential antimicrobial target.

Comparison of Cardiolipin Synthase Properties Across Bacterial Species

SpeciesPrimary CL SynthaseSize (amino acids)Active Site ResiduesSubstrate PreferenceCellular Localization
Salmonella choleraesuisClsA486His217 (predicted)PG + PGInner membrane
Escherichia coliClsA486His224PG + PGInner membrane
Shigella flexneriClsA486His224 (predicted)PG + PGInner membrane
Enterococcus faeciumCls~430His215PG + PGInner membrane

Effect of Growth Phase on Cardiolipin Levels and Synthase Activity

Growth PhaseCardiolipin Level in S. flexneriPrimary Active SynthaseTranscriptional RegulationPG:PE:CL Ratio
Exponential~7% of total phospholipidsClsABasal expressionHigh PG, Low CL
Stationary~10% of total phospholipidsClsA, ClsCIncreased cls expressionLower PG, Higher CL
IntracellularNot determinedClsA, increased ClsB/C expression~10-fold induction of clsB/CNot determined

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.