Recombinant Salmonella choleraesuis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Biochemical Role of CobS in Salmonella

CobS catalyzes the penultimate step in adenosylcobalamin synthesis, assembling the nucleotide loop that links the corrin ring to the lower-ligand base (5,6-dimethylbenzimidazole or α-ribazole) . Key findings include:

  • Catalytic Function: CobS synthesizes adenosylcobalamin-5′-phosphate (AdoCbl-5′-P) from adenosylcobinamide-GDP and α-ribazole-5′-phosphate .

  • Membrane Localization: CobS is an integral inner membrane protein, interacting with membrane stress responses in S. enterica .

  • Dephosphorylation: CobC dephosphorylates AdoCbl-5′-P to AdoCbl, completing the nucleotide loop assembly .

Table 1: Key Biochemical Features of CobS

FeatureDescriptionOrganismReference
Catalytic ActivitySynthesizes AdoCbl-5′-P from AdoCbi-GDP and α-ribazole-5′-PS. typhimurium
Subcellular LocalizationInner membrane protein; linked to membrane stress in S. entericaS. enterica
Substrate SpecificityUtilizes α-ribazole-5′-P over free α-ribazoleS. typhimurium

Recombinant Applications of Salmonella choleraesuis

While S. choleraesuis itself is not a primary source of native CobS, it serves as a recombinant vector for heterologous antigen expression. Recent studies highlight its use in vaccine development:

  • Vaccine Platform: Attenuated S. choleraesuis strains (e.g., rSC0016) have been engineered to express antigens like PlpE (from Pasteurella multocida) and SaoA (from Streptococcus suis) .

  • Safety and Immunogenicity: These vectors induce robust systemic (IgG) and mucosal (IgA) immune responses in mice, with reduced inflammation due to sopB gene knockout .

Table 2: Recombinant Applications of S. choleraesuis

ApplicationAntigen ExpressedOutcomeReference
Vaccine DevelopmentPlpE (P. multocida)80% survival against P. multocida challenge
Vaccine DevelopmentSaoA (S. suis)High protection against S. suis

Research Gaps and Future Directions

  • Lack of Direct Studies: No studies explicitly report recombinant CobS expression in S. choleraesuis. Current research focuses on CobS in S. typhimurium or S. enterica.

  • Vaccine Synergy: While S. choleraesuis is a proven vaccine vector, integrating CobS expression could enable dual-purpose systems (e.g., vitamin biosynthesis and antigen delivery).

  • Membrane Dynamics: Further studies are needed to clarify the timing of CobC-mediated dephosphorylation in vivo and its impact on AdoCbl-5′-P stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please include them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; SCH_2025; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLTKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Salmonella choleraesuis catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: sec:SCH_2025

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the cobS gene and what is its role in cobalamin biosynthesis?

The cobS gene encodes cobalamin synthase, an enzyme that catalyzes the final step in the biosynthesis of adenosylcobamide (coenzyme B12) in Salmonella enterica . This crucial enzyme completes the vitamin B12 biosynthetic pathway by facilitating the attachment of the lower axial ligand to the corrin ring structure. The cobS gene is part of the broader cob operon, which contains approximately 20 genes involved in the de novo synthesis of cobalamins . Understanding cobS function is essential for comprehending the complete B12 biosynthetic pathway in Salmonella species and related bacteria.

Where is the Cobalamin synthase (cobS) protein localized in bacterial cells?

Cobalamin synthase is localized to the cell membrane, specifically the inner membrane, in Salmonella enterica . This localization has been confirmed through multiple experimental approaches, including isopycnic density ultracentrifugation to separate inner and outer membranes, immunoblotting with antibodies against CobS, and protein fusion experiments using CobS-alkaline phosphatase and CobS-beta-galactosidase constructs . Computer analysis of the predicted amino acid sequence suggests cobS is an integral membrane protein, a finding that was experimentally validated. This membrane localization has significant implications for experimental design when studying cobS function and expression.

How does cobS expression differ between aerobic and anaerobic conditions?

Cobalamin synthesis, including cobS expression and function, is only observed under anaerobic conditions in both native Salmonella typhimurium and recombinant E. coli strains containing the S. typhimurium cob operon . This oxygen-dependent regulation represents a critical consideration for experimental design when studying cobS. Researchers must ensure proper anaerobic cultivation techniques to achieve functional expression. The mechanism behind this anaerobic requirement may relate to the sensitivity of pathway intermediates to oxidation or to evolutionary adaptations in regulatory elements controlling the expression of the cob operon genes.

What are the key considerations when designing experiments to study cobS function?

When designing experiments to study cobS function, researchers should implement a multifaceted approach that accounts for the protein's unique characteristics:

  • Oxygen conditions must be strictly controlled, as cobalamin synthesis only occurs under anaerobic conditions . Establish reliable anaerobic chambers or growth systems.

  • Consider the membrane localization of CobS when designing purification or activity assays . Standard soluble protein protocols will be ineffective.

  • Include appropriate genetic contexts, as the function of cobS depends on other genes in the cob operon . Isolated expression may not yield functional protein.

  • Incorporate cobalt supplementation in experimental media, as cobalt is required at an early stage in the biosynthesis pathway . Without adequate cobalt, precursors like precorrin-2 and precorrin-3 will accumulate.

  • Monitor membrane stress responses, such as PspA accumulation, when overexpressing cobS . Excessive expression can compromise membrane integrity.

  • Develop appropriate detection systems for both the protein (antibodies, fusion reporters) and its enzymatic products (microbiological assays) .

What methods are most effective for analyzing cobS membrane localization?

MethodTechnical ApproachAdvantagesLimitationsKey Finding
Membrane FractionationIsopycnic density ultracentrifugation to separate inner and outer membranesDirect biochemical evidence of localizationLabor intensive; potential cross-contaminationCobS activity associated with inner membrane
ImmunoblottingWestern blot using specific anti-CobS antibodiesSpecific detection of native proteinRequires high-quality antibodiesConfirmed inner membrane localization
Protein FusionsConstruction of CobS-alkaline phosphatase or CobS-β-galactosidase fusionsProvides topology informationFusion may alter native structureConsistent with membrane localization
Computational AnalysisPrediction of transmembrane domains from amino acid sequenceRapid; guides experimental designPredictions require validationSuggested integral membrane protein structure
Activity AssaysMeasuring enzymatic activity in different cellular fractionsConnects location with functionRequires sensitive functional assayActivity concentrated in membrane fraction

This systematic approach combining multiple complementary methods provides robust evidence for cobS membrane localization and should be considered the gold standard for such studies .

How can researchers quantify cobalamin production in recombinant systems?

Quantification of cobalamin production in recombinant systems requires selection of appropriate analytical methods based on research objectives:

Analytical MethodAdvantagesLimitationsApplications
Microbiological Assay- High sensitivity
- Measures bioavailable cobalamin
- Established method in literature
- Time-consuming
- Requires indicator organism maintenance
- Quantification of total cobalamin
- Demonstrated 100-fold increase in recombinant strains
HPLC Analysis- Good separation of intermediates
- Quantitative and reproducible
- Lower sensitivity than bioassays
- Requires standards
- Identification of specific cobalamin forms
- Monitoring of conversion efficiency
Mass Spectrometry- Highest specificity
- Can identify novel intermediates
- Complex sample preparation
- Specialized expertise required
- Structural characterization
- Identified accumulation of precorrin-2 and precorrin-3
Radioisotope Tracing- High sensitivity
- Pathway dynamics assessment
- Radiation safety concerns
- Specialized facilities required
- Biosynthetic pathway mapping
- Rate-limiting step identification

Researchers have successfully employed microbiological assays to demonstrate that recombinant E. coli strains containing the S. typhimurium cob operon produced up to 100 times more corrin than the parent S. typhimurium strain . This approach remains the standard for quantifying functional cobalamin production.

What are the optimal conditions for expressing recombinant cobS in heterologous hosts?

Successful expression of functional recombinant cobS requires careful optimization of multiple parameters:

ParameterOptimal ConditionEffect on ExpressionEvidence
Oxygen StatusAnaerobicRequired for cobalamin synthesis activationCobalamin synthesis only observed under anaerobic conditions
Genetic ContextComplete cob operon (20 genes)Supports functional expressionTransfer of 20 genes resulted in functional expression in E. coli
Expression LevelModeratePrevents membrane stressHigh expression causes PspA accumulation
Cobalt AvailabilitySupplementedPrevents precursor accumulationPrecorrin-2 and precorrin-3 accumulate without cobalt
Host SelectionCompatible speciesAffects complementation successS. typhimurium cbiL mutants not complemented by P. denitrificans gene
Vector DesignRegulated expression systemPrevents toxicityRegulated systems improve viability of recombinant strains

The interplay between these factors is critical. For example, even with optimal genetic constructs, the absence of anaerobic conditions will prevent functional expression. Similarly, without cobalt supplementation, the pathway will stall at early intermediates regardless of cobS expression levels .

How can researchers construct an effective recombinant Salmonella choleraesuis vector for cobS expression?

Construction of an effective recombinant S. choleraesuis vector for cobS expression should follow a systematic approach incorporating principles from successful Salmonella vector development and cobalamin pathway engineering :

  • Select an appropriate attenuated S. choleraesuis strain, such as rSC0016, which features regulated delayed attenuation and antigen expression systems . These systems allow initial robust replication followed by controlled attenuation.

  • Implement safety features through genetic modification, such as sopB gene knockout, which reduces host inflammatory responses while maintaining vector functionality .

  • Design expression cassettes with carefully selected promoters that balance expression efficiency with minimal membrane stress, as overexpression induces PspA accumulation indicating membrane stress .

  • Consider co-expression of multiple cob operon genes, as functional cobS often requires the genetic context of supporting biosynthetic enzymes . The successful transfer of 20 genes from the S. typhimurium cob operon to E. coli demonstrates this necessity .

  • Incorporate membrane protein optimization strategies, including potential fusion partners or secretion signals that facilitate proper membrane integration, as cobS is an integral membrane protein localized to the inner membrane .

  • Include appropriate selection markers and verification elements to enable stable maintenance and confirmation of the construct.

What complementation strategies are most effective for validating cobS function?

Effective complementation strategies for validating cobS function must address several layers of complexity:

  • Genetic Complementation Design:

    • Full operon vs. single gene: Complete restoration often requires multiple genes from the cob operon, as demonstrated by the transfer of 20 genes in functional recombinant systems .

    • Expression control: Regulated promoters prevent toxic overexpression while ensuring sufficient protein levels.

    • Codon optimization: May be necessary when expressing across distantly related species.

  • Species Compatibility Considerations:

    • Homologous complementation: Using cobS from the same or closely related species generally yields higher success rates.

    • Cross-species limitations: Evidence suggests some pathway components may not be interchangeable between distantly related species, as seen with the failure of P. denitrificans cbiL to complement S. typhimurium cbiL mutants .

  • Validation Approach:

    • Growth-based complementation: Assessing the ability of recombinant cobS to restore growth in cobS-deficient strains under conditions requiring cobalamin.

    • Biochemical complementation: Measuring restoration of cobalamin production using microbiological assays .

    • Intermediate analysis: Monitoring the conversion of pathway intermediates that would otherwise accumulate in cobS mutants.

  • Environmental Controls:

    • Anaerobic conditions: Essential for functional complementation given the strict anaerobic requirement for cobalamin synthesis .

    • Cobalt supplementation: Necessary to prevent accumulation of precursors like precorrin-2 and precorrin-3 .

How should researchers interpret conflicting data regarding cobS membrane localization?

When confronted with conflicting data regarding cobS membrane localization, researchers should implement a systematic resolution approach:

  • Methodological Analysis: Evaluate differences in experimental techniques. Lawrence et al. established cobS inner membrane localization using multiple complementary methods: isopycnic density ultracentrifugation, immunoblotting, computer analysis, and protein fusion experiments . Conflicting studies may have relied on fewer or different methodologies.

  • Expression System Comparison: Assess whether different expression systems affect localization. Overexpression can cause protein mislocalization or aggregation, potentially explaining discrepancies between studies.

  • Construct Design Evaluation: Analyze whether protein tags or fusion partners in different studies may have influenced localization outcomes. The position (N-terminal vs. C-terminal) and nature of tags can significantly alter membrane protein topology.

  • Membrane Fractionation Quality: Examine the purity and separation quality of membrane fractions in conflicting studies. Cross-contamination between inner and outer membrane fractions is a common source of discrepancies.

  • Develop an Integrated Model: Follow the approach of Lawrence et al. , who modified their initial predicted model based on experimental protein fusion data. This iterative approach, refining models as new data emerges, represents best practice for resolving conflicting membrane protein topology data.

  • Functional Correlation: Determine whether localization patterns correlate with enzyme activity. Fractions showing highest cobS enzymatic activity should contain the correctly localized protein .

What statistical approaches are recommended for analyzing cobalamin production data?

Statistical ApproachApplicationImplementation GuidanceReporting Standards
Descriptive StatisticsInitial data characterizationCalculate mean, median, standard deviation, coefficient of variationReport central tendency and dispersion measures for all experimental groups
Normality TestingDetermine appropriate parametric/non-parametric testsShapiro-Wilk or Kolmogorov-Smirnov testsReport test statistics and p-values
Comparative AnalysisGroup comparisonst-tests (two groups) or ANOVA with post-hoc tests (multiple groups)Report test statistics, degrees of freedom, p-values, and effect sizes
Fold-Change AnalysisProduction efficiencyCalculate fold-change relative to control strainsReport as in published studies (e.g., "100 times more corrin than parent strain")
Regression AnalysisIdentify influential variablesMultiple regression for complex datasetsReport R², adjusted R², significant predictors, and model equations
Time-Series AnalysisProduction kineticsRepeated measures ANOVA or mixed modelsReport time effects, group×time interactions
Power AnalysisExperimental designA priori calculations to determine sample sizeReport achieved power and minimum detectable effect size

When reporting data demonstrating significant production increases, as in the case of recombinant E. coli strains producing 100 times more corrin than parent S. typhimurium strains , it is essential to clearly communicate both the magnitude of effect and its statistical significance.

How can researchers effectively validate the functionality of recombinant cobS protein?

Validation of recombinant cobS functionality requires a multifaceted approach:

Validation MethodExperimental ApproachExpected OutcomeTroubleshooting
Complementation TestingExpress recombinant cobS in cobS-deficient strainsRestoration of cobalamin synthesis abilityIf unsuccessful, verify anaerobic conditions and genetic construct integrity
Enzymatic Activity AssayMeasure conversion of substrate to adenosylcobamideDetectable activity in membrane fractions containing cobSOptimize detergent conditions for membrane protein extraction
Cobalamin QuantificationMicrobiological assay as performed by Raux et al. Measurable cobalamin productionEnsure proper anaerobic growth conditions throughout testing
Precursor AnalysisChromatographic/mass spectrometric analysis of intermediatesAbsence of accumulated precorrin-2 and precorrin-3 when cobS is functionalCheck cobalt availability, as insufficiency causes precursor accumulation
Membrane LocalizationMembrane fractionation and immunoblottingDetection in inner membrane fractionVerify antibody specificity and fractionation quality
Protein-Protein InteractionCo-immunoprecipitation with other cob pathway proteinsIdentification of interaction partnersConsider crosslinking approaches for transient interactions

The gold standard for validation combines multiple approaches, as exemplified by studies showing both proper membrane localization and functional complementation resulting in measurable cobalamin production .

How might cobS engineering contribute to developing improved Salmonella-based vaccine vectors?

Engineering of cobS and related cobalamin biosynthesis pathways offers several promising avenues for enhancing Salmonella-based vaccine vector performance:

  • Metabolic Optimization: Engineered cobS expression could enhance vector fitness and persistence in host tissues through optimized B12-dependent metabolism. This may improve antigen delivery duration and immune stimulation profiles similar to improvements seen in attenuated Salmonella vaccine vectors .

  • Regulated Expression Systems: Integrating cobS into sophisticated genetic control systems, similar to the regulated delayed attenuation system in vector rSC0016 , could create vectors with precisely timed metabolic profiles optimized for immune response induction.

  • Immune Modulation: Cobalamin metabolites could potentially serve as immunomodulatory molecules, influencing dendritic cell maturation or T-cell polarization. This could enhance the mixed Th1/Th2-type responses observed with recombinant attenuated Salmonella vaccines .

  • Mucosal Immunity Enhancement: Since recombinant attenuated Salmonella vaccines induce strong mucosal immunity , engineering cobS function could potentially enhance vector performance at mucosal surfaces where B12-dependent metabolism might provide competitive advantages.

  • Attenuation Refinement: Controlled impairment of cobS function could provide an additional attenuation mechanism, contributing to safety while preserving immunogenicity, similar to the strategy of knocking out sopB to reduce inflammatory responses .

  • Vector Stability Improvement: Optimized cobS expression could enhance vector metabolic stability in vivo, potentially improving the consistency of immune responses similar to how recombinant attenuated Salmonella vaccines demonstrated robust immune response induction .

What emerging technologies might overcome current limitations in cobS research?

Research ChallengeEmerging TechnologyPotential ApplicationExpected Advancement
Membrane Protein Structure DeterminationCryo-electron microscopy (cryo-EM)High-resolution structural analysis of membrane-embedded cobSDetailed mechanism of cobS catalytic function
Functional Analysis in Native EnvironmentSuper-resolution microscopyVisualization of cobS localization and dynamics in living cellsUnderstanding of cobalamin synthesis microdomains
Multi-gene Pathway EngineeringCRISPR-Cas9 multiplexingSimultaneous modification of multiple genes in the cob operonCreation of optimized cobalamin production strains
Protein-Protein InteractionsProximity labeling proteomicsIdentification of cobS interaction partners in membrane environmentMap of cobalamin synthesis protein complexes
Expression OptimizationMachine learning-guided codon optimizationDesign of expression constructs with optimal translation efficiencyImproved heterologous expression systems
Oxygen SensitivityDirected evolutionSelection of cobS variants with reduced oxygen sensitivityDevelopment of aerotolerant cobalamin synthesis
Membrane IntegrationDe novo protein designEngineering optimized membrane domainsEnhanced membrane integration of recombinant cobS

These emerging technologies address key limitations identified in the literature, such as the challenges of studying membrane-localized cobS and the strict anaerobic requirements for cobalamin synthesis .

How does cobS function compare across different bacterial species, and what are the evolutionary implications?

Comparative analysis of cobS function across bacterial species reveals important evolutionary patterns with significant research implications:

  • Functional Conservation with Sequence Divergence: The successful transfer of S. typhimurium cob operon to E. coli restored cobalamin synthesis in the recipient , suggesting functional conservation despite E. coli having likely lost this ability through evolution. This indicates the core enzymatic mechanism of cobS is preserved across related species.

  • Pathway-Specific Adaptations: The observation that S. typhimurium cbiL mutants were not complemented by the homologous Pseudomonas denitrificans gene suggests species-specific adaptations within the pathway. This non-interchangeability between distantly related species highlights evolutionary divergence in how different organisms have optimized the same biochemical pathway.

  • Regulatory Conservation: The finding that cobalamin synthesis occurs only under anaerobic conditions in both native S. typhimurium and recombinant E. coli indicates conservation of regulatory mechanisms governing the pathway. This oxygen-dependent regulation represents a fundamental evolutionary constraint on the pathway.

  • Membrane Localization as Adaptation: The inner membrane localization of cobS in S. enterica may represent an evolutionary adaptation facilitating interaction with other pathway components or substrate channeling. Comparative localization studies across diverse bacterial lineages would reveal whether this is a universal feature or lineage-specific adaptation.

  • Horizontal Gene Transfer Potential: The successful functional transfer of the entire cob operon between species suggests that horizontal gene transfer could have played a significant role in distributing cobalamin synthesis capabilities across bacterial lineages throughout evolutionary history.

  • Anaerobic vs. Aerobic Pathway Evolution: Different bacteria synthesize cobalamin through either aerobic or anaerobic pathways. Salmonella utilizes the anaerobic pathway, while other bacteria like P. denitrificans employ the aerobic pathway. This divergence represents alternative evolutionary solutions to produce the same essential cofactor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.