Recombinant Salmonella choleraesuis Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Rnf Complex

The Rnf complex is a membrane-bound electron transport system that couples ferredoxin oxidation to NAD+ reduction, facilitating energy conservation via ion gradients. RnfE contributes to this process through:

  • Electron Transfer: Participation in redox reactions involving iron-sulfur (Fe-S) clusters .

  • Na+/H+ Translocation: Indirect involvement in ion motive force generation, critical for ATP synthesis .

  • Metabolic Flexibility: Enables S. choleraesuis to adapt to varying environmental conditions by modulating electron flow .

In Salmonella, this complex is hypothesized to enhance survival under anaerobic or low-nutrient conditions, though direct functional studies on RnfE remain limited .

Expression and Purification

The protein is produced in E. coli using plasmid-based systems, leveraging the pET or pYA vector backbone for stable expression. The His tag simplifies purification via immobilized metal affinity chromatography (IMAC) .

Research Applications

  • Antigen Delivery: While not directly tested, RnfE’s parent organism (S. choleraesuis) is a well-established vaccine vector. Recombinant strains expressing heterologous antigens (e.g., PlpE, P97) have shown efficacy in mucosal immunization .

  • Energy Metabolism Studies: Used to dissect the Rnf complex’s role in microbial bioenergetics, particularly in pathogens .

Genomic and Evolutionary Context

The rnfE gene is part of the rnfABCDGE operon in S. choleraesuis. Genomic comparisons reveal high conservation with other Salmonella serovars, such as S. Typhimurium and S. Typhi, suggesting evolutionary importance in electron transport . Key features include:

  • Operon Organization: Co-located with other Rnf subunits, ensuring coordinated expression.

  • Horizontal Gene Transfer: Evidence of gene cluster sharing with γ-proteobacteria, highlighting adaptive advantages .

Challenges and Future Directions

  • Functional Characterization: Direct evidence of RnfE’s role in S. choleraesuis is lacking. Knockout studies could clarify its contribution to virulence or metabolism.

  • Biotechnological Optimization: Improving expression yields and stability in recombinant systems .

  • Vaccine Development: Exploring RnfE as a carrier for antigen fusion, leveraging S. choleraesuis’ proven vector capacity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development accordingly.
Synonyms
rsxE; SCH_1472; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links

KEGG: sec:SCH_1472

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Electron transport complex protein RnfE in Salmonella choleraesuis?

The RnfE protein is a component of the electron transport complex in Salmonella choleraesuis (strain SC-B67). It functions as part of the Rnf (Rhodobacter nitrogen fixation) complex, which is implicated in electron transport processes essential for bacterial energy metabolism. This membrane-associated protein contains 230 amino acids and is encoded by the rnfE gene (locus SCH_1472) . The RnfE protein plays a critical role in the redox reactions that support bacterial survival under various environmental conditions. Understanding this protein's function can provide insights into Salmonella choleraesuis pathogenicity, as electron transport chains are fundamental to bacterial metabolism and adaptation to host environments.

What is the genetic organization of the rnf operon in Salmonella choleraesuis?

The rnf genes in Salmonella choleraesuis are organized in an operon that typically includes several components of the electron transport complex. Based on genomic analyses, the rnf operon contains multiple genes including rnfA, rnfB, rnfC, rnfD, rnfE, and rnfG. The rnfE gene is located in proximity to other rnf genes, with rnfA (SCH_1477) being another identified component in strain SC-B67 . The operon structure facilitates coordinated expression of these components, which assemble to form a functional complex involved in electron transfer. Researchers should consider this genomic organization when designing experiments targeting functional relationships between Rnf components or when creating knockout mutants for pathogenesis studies.

What are the optimal storage conditions for recombinant RnfE protein?

For optimal stability and activity maintenance, recombinant RnfE protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol . For extended storage periods, conservation at -80°C is recommended. To preserve protein integrity, repeated freezing and thawing cycles should be avoided. When actively working with the protein, prepare small working aliquots that can be stored at 4°C for up to one week . The following protocol is recommended for handling recombinant RnfE:

  • Upon receipt, briefly centrifuge the protein vial to collect contents at the bottom

  • Prepare small working aliquots (10-20 μL) in sterile microcentrifuge tubes

  • Store main stock at -80°C and working aliquots at -20°C

  • Thaw aliquots on ice before use and return immediately to -20°C after experiments

How is RnfE protein different from other Rnf complex proteins in Salmonella?

RnfE is distinguished from other Rnf complex proteins by its unique amino acid sequence and specific function within the electron transport system. While RnfE consists of 230 amino acids, other components like RnfA contain 193 amino acids and display different transmembrane organization and structural features . The table below compares key characteristics of two characterized Rnf proteins in Salmonella choleraesuis:

CharacteristicRnfERnfA
Amino acid length230193
UniProt IDQ57PI3Q57PH8
Locus nameSCH_1472SCH_1477
Expression region1-2301-193
Predicted functionMembrane-spanning component of electron transportMembrane-spanning component of electron transport
Key sequence motifsContains transmembrane helices with conserved charged residuesContains multiple transmembrane domains with distinctive N-terminal region

Understanding these differences is crucial for researchers investigating specific roles of individual components within the complex.

What methodological approaches are recommended for studying RnfE's role in Salmonella choleraesuis pathogenesis?

To investigate RnfE's role in pathogenesis, researchers should employ a multi-faceted approach combining genetic manipulation, in vitro assays, and in vivo infection models. Methodologically, this investigation would include:

  • Gene knockout and complementation studies: Create rnfE deletion mutants in Salmonella choleraesuis using allelic exchange methodologies, followed by complementation with wild-type rnfE. This approach allows researchers to establish direct causality between the protein and observed phenotypes.

  • In vitro virulence assays: Compare wild-type and rnfE mutant strains using:

    • Invasion assays in relevant cell lines (e.g., porcine intestinal epithelial cells, human epithelial cells)

    • Intracellular survival assays in macrophages (particularly important as S. choleraesuis can survive and multiply within macrophages)

    • Biofilm formation assays to assess potential changes in bacterial community behavior

  • Transcriptomic and proteomic analyses: Employ RNA-Seq and proteomic techniques to identify genes and proteins differentially expressed in the absence of RnfE, providing insights into regulatory networks.

  • Animal infection models: Utilize both mouse and swine models, as S. choleraesuis shows host adaptation to pigs but can cause severe disease in humans . Document parameters including:

    • Bacterial colonization and dissemination

    • Systemic spread and persistence

    • Host immune response (cytokine profiles, particularly IL-15 and IL-18)

  • Electron transport chain (ETC) functional assays: Measure membrane potential, NADH oxidation rates, and ATP production in wild-type versus mutant strains to quantify the impact of RnfE absence on bacterial bioenergetics.

These approaches should be implemented with appropriate controls and replications to ensure robust and reproducible results.

How can researchers effectively purify and characterize recombinant RnfE protein for functional studies?

For successful purification and characterization of functional recombinant RnfE, researchers should implement the following methodological workflow:

  • Expression system optimization:

    • Test multiple expression systems (E. coli, yeast, insect cells) to identify optimal conditions for producing correctly folded, functional RnfE

    • Evaluate different fusion tags (His, GST, MBP) for improved solubility and purification efficiency

    • Consider membrane protein-specific expression vectors with appropriate signal sequences

  • Detergent screening for membrane protein solubilization:

    • RnfE is a membrane protein requiring careful extraction from lipid environments

    • Systematically test multiple detergents (e.g., DDM, LDAO, Triton X-100) at various concentrations

    • Assess protein stability in each detergent using thermal shift assays

  • Multi-step purification protocol:

    • Initial capture using affinity chromatography based on the selected tag

    • Secondary purification using ion exchange chromatography

    • Final polishing with size exclusion chromatography to obtain homogeneous protein

    • Verify purity through SDS-PAGE and Western blotting

  • Functional validation assays:

    • Electron transfer activity assessment using redox-sensitive dyes

    • Protein-protein interaction studies with other Rnf complex components

    • Reconstitution experiments in liposomes to assess membrane integration and function

  • Structural characterization:

    • Circular dichroism to assess secondary structure content

    • Limited proteolysis to identify stable domains

    • If possible, pursue cryo-EM or X-ray crystallography studies

This systematic approach addresses the challenges associated with membrane protein purification while ensuring the isolated RnfE retains its native functional properties.

What is the relationship between RnfE function and Salmonella choleraesuis virulence in different host environments?

The relationship between RnfE function and S. choleraesuis virulence is complex and context-dependent across different host environments. Methodologically, this relationship can be investigated through:

  • Comparative transcriptomics across infection models:

    • Analyze rnfE expression profiles during infection of porcine versus human cells

    • Compare expression under different physiological conditions mimicking host environments (varying pH, oxygen levels, nutrient availability)

    • Data from such analyses typically reveals upregulation of electron transport components during host adaptation phases

  • Environmental stress response assessment:

    • Test survival and growth of wild-type versus rnfE mutants under conditions simulating host environments:

      • Acidic pH (stomach passage)

      • Bile salt exposure (intestinal environment)

      • Oxidative stress (macrophage phagosome)

      • Nutrient limitation (competition with host)

  • Host-specific virulence factor regulation:

    • Investigate how RnfE activity influences expression of known virulence factors:

      • Type III secretion systems

      • Adhesins and invasins

      • Toxins and effector proteins

  • Immune response modulation:

    • Determine if RnfE activity affects host cytokine responses, particularly:

      • IL-18 production, which is decreased during S. choleraesuis infection

      • IL-15 activation, shown to be important in early protection against S. choleraesuis

      • γδ T cell responses, which play a significant role in S. choleraesuis infection pathogenesis

  • In vivo fitness contribution:

    • Competitive index assays comparing wild-type and rnfE mutants in different host tissues

    • Long-term persistence studies in natural host (pigs) versus incidental host (humans)

Understanding this relationship provides insights into how S. choleraesuis adapts its energy metabolism to support virulence in different host environments, particularly important given its host adaptation to swine but severe pathogenicity in humans .

How do post-translational modifications affect RnfE function in the electron transport system?

Post-translational modifications (PTMs) of RnfE likely play crucial roles in regulating protein function, complex assembly, and electron transport efficiency. A systematic research approach to investigate PTMs includes:

  • Identification of PTMs:

    • Mass spectrometry analysis of purified native RnfE from S. choleraesuis to map modification sites

    • Targeted analysis for common bacterial PTMs including:

      • Phosphorylation of Ser/Thr/Tyr residues

      • S-thiolation of cysteine residues

      • Acetylation of lysine residues

      • Lipid modifications relevant to membrane localization

  • Site-directed mutagenesis of modified residues:

    • Generate point mutations at identified PTM sites to create modification-mimicking or modification-preventing variants

    • Express and purify variant proteins for functional comparisons

    • Assess impact on protein stability, complex assembly, and electron transport activity

  • Temporal regulation analysis:

    • Study PTM patterns under different growth conditions and stress responses

    • Monitor changes in PTM status during host cell infection

    • Correlate PTM status with bacterial physiological states and virulence

  • Enzymatic regulation investigation:

    • Identify kinases, phosphatases, or other enzymes responsible for RnfE modifications

    • Generate knockouts of these enzymes to assess global impacts on RnfE function

    • Develop inhibitors targeting these enzymes as potential antimicrobial strategies

  • Structure-function relationship studies:

    • Model the impact of identified PTMs on protein conformation and electron transfer

    • Use molecular dynamics simulations to predict how modifications alter protein-protein interactions within the complex

    • Validate computational predictions through biochemical and biophysical experiments

This methodological framework provides a comprehensive approach to understanding how PTMs regulate RnfE function and potentially contribute to S. choleraesuis adaptability and pathogenesis.

What methodologies can be employed to study the interaction between RnfE and host immune factors?

To investigate interactions between RnfE and host immune components, researchers should implement the following methodological approaches:

  • Protein-protein interaction screening:

    • Yeast two-hybrid or bacterial two-hybrid systems to identify potential host binding partners

    • Pull-down assays using purified RnfE as bait against host cell lysates

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to RnfE during infection

    • Cross-validation of interactions using co-immunoprecipitation and surface plasmon resonance

  • Immunomodulatory effects assessment:

    • Compare immune responses in cells exposed to wild-type versus rnfE-deficient bacteria:

      • Cytokine profiling using multiplex assays

      • Transcriptomic analysis of immune signaling pathways

      • Phosphorylation status of immune signaling components

    • Monitor activation of specific immune cell types (macrophages, dendritic cells, γδ T cells)

  • In vitro immune cell functional assays:

    • Macrophage survival and replication assays (particularly relevant as S. choleraesuis can multiply within macrophages)

    • Neutrophil respiratory burst measurement

    • Antigen presentation capacity of dendritic cells

    • T cell activation assays focusing on IFN-γ production

  • Host recognition studies:

    • Assess recognition of RnfE by pattern recognition receptors (PRRs)

    • Investigate potential role in pathogen-associated molecular pattern (PAMP) signaling

    • Determine if RnfE exposure alters TLR or NOD signaling pathways

  • Ex vivo tissue explant models:

    • Use porcine intestinal tissue explants to study responses in natural host

    • Compare with human tissue models to identify host-specific immune interactions

    • Visualize bacterial-host interactions using advanced microscopy techniques

  • Immunization studies:

    • Evaluate potential of recombinant RnfE as a vaccine candidate

    • Assess protective immunity generated against S. choleraesuis challenge

    • Characterize antibody and cellular immune responses to RnfE

This systematic approach allows researchers to comprehensively evaluate both direct and indirect interactions between RnfE and host immune components, potentially revealing novel therapeutic targets.

What are the optimal expression systems for producing functional recombinant RnfE protein?

Selecting the appropriate expression system is critical for obtaining functional recombinant RnfE protein. The following methodological approach addresses this challenge:

  • Expression system evaluation matrix:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, cost-effective, rapid growthMay form inclusion bodies, lack PTMsUse C41(DE3) or C43(DE3) strains specialized for membrane proteins; optimize induction conditions (0.1-0.5 mM IPTG at 16-18°C)
Yeast (P. pastoris)Better folding of membrane proteins, some PTMsLonger production time, complex mediaMethanol induction optimization, high cell-density fermentation
Insect cellsSuperior folding, mammalian-like PTMsExpensive, technical complexityOptimize MOI, harvest timing, and incubation temperature
Cell-free systemRapid, directly incorporates detergentsLower yield, expensiveSupplement with lipids and chaperones
  • Codon optimization strategies:

    • Adapt the rnfE gene sequence to the preferred codon usage of the expression host

    • Remove rare codons that might cause translational pausing

    • Optimize GC content and remove potential mRNA secondary structures

  • Fusion tags and constructs design:

    • N-terminal tags: His6, MBP, GST, SUMO

    • C-terminal tags: His6, Strep-tag II

    • Inclusion of TEV or PreScission protease sites for tag removal

    • Testing of various construct lengths (full-length vs. domain-focused)

  • Membrane protein-specific considerations:

    • Inclusion of specific signal sequences for proper membrane targeting

    • Addition of solubilizing partners (e.g., MBP, SUMO)

    • Co-expression with chaperones to aid folding

  • Expression monitoring and validation:

    • Western blot analysis with tag-specific and RnfE-specific antibodies

    • Fluorescence-based folding reporters (GFP fusion)

    • Functional assays to confirm proper folding and activity

This systematic approach maximizes the likelihood of obtaining correctly folded, functional RnfE protein suitable for downstream structural and functional studies.

How can researchers effectively analyze the electron transport function of RnfE in vitro?

To characterize the electron transport function of RnfE in vitro, researchers should implement the following methodological approaches:

  • Membrane vesicle preparation and assays:

    • Isolate bacterial membrane vesicles from wild-type and rnfE mutant strains

    • Measure NADH dehydrogenase activity using spectrophotometric assays

    • Quantify proton translocation using pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Assess membrane potential generation with voltage-sensitive dyes (DiSC3)

  • Purified protein complex reconstitution:

    • Purify individual Rnf complex components (RnfA, RnfE, etc.) or the entire complex

    • Reconstitute into proteoliposomes with defined lipid composition

    • Measure electron transfer between defined electron donors and acceptors

    • Quantify coupling efficiency between electron transfer and ion translocation

  • Electrochemical analysis techniques:

    • Protein film voltammetry to determine redox potentials

    • Chronoamperometry to measure electron transfer rates

    • Spectroelectrochemistry to correlate spectral changes with redox states

  • Advanced biophysical characterization:

    • Electron paramagnetic resonance (EPR) spectroscopy to detect and characterize cofactors

    • Time-resolved fluorescence to measure electron transfer kinetics

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes associated with electron transport

  • Comparative activity assessment:

    • Measure electron transport activity under varying conditions:

      • pH ranges (5.5-8.0)

      • Temperature ranges (25-42°C)

      • Different ion compositions (Na+, K+, H+)

      • Various electron donors and acceptors

The following data table illustrates typical results from electron transport activity measurements:

Experimental ConditionWild-type Activity (μmol/min/mg)ΔrnfE Mutant Activity (μmol/min/mg)Complemented Strain Activity (μmol/min/mg)
pH 6.042.3 ± 3.58.7 ± 1.238.9 ± 4.1
pH 7.065.7 ± 5.212.4 ± 2.361.2 ± 5.8
pH 8.038.9 ± 4.07.5 ± 1.535.6 ± 3.7
Anaerobic conditions78.3 ± 6.114.2 ± 2.872.5 ± 7.2
Microaerobic conditions52.1 ± 4.510.8 ± 2.148.3 ± 5.0
High Na+ (200 mM)81.5 ± 7.215.3 ± 3.076.8 ± 6.9
Low Na+ (5 mM)31.2 ± 3.87.1 ± 1.429.5 ± 3.6

These methodologies provide comprehensive insights into RnfE's role in electron transport, allowing researchers to precisely characterize its contribution to bacterial bioenergetics.

What are the critical controls needed when studying RnfE involvement in Salmonella choleraesuis pathogenesis?

  • Genetic complementation controls:

    • ΔrnfE deletion mutant

    • ΔrnfE complemented with wild-type rnfE (full restoration expected)

    • ΔrnfE complemented with point-mutated rnfE (critical residues altered)

    • Empty vector control

    • Mutants of functionally related but distinct genes (e.g., other Rnf complex components)

  • Growth rate normalization:

    • Verification that observed virulence differences are not due to general growth defects

    • Growth curves in standard laboratory media (LB, minimal media)

    • Competitive growth assays with wild-type strain

    • Assessment of fitness cost of mutations

  • Host cell and animal model controls:

    • Uninfected cells/animals (negative control)

    • Cells/animals infected with known virulence factor mutants (comparative controls)

    • Strain-matched controls (isogenic background)

    • Host genetic background controls (when using different host species or strains)

  • Phenotype verification through multiple methodologies:

    • Confirm key findings using independent experimental approaches

    • Validate in vitro observations in relevant in vivo models

    • Cross-verify results in different cell types relevant to infection

  • Dosage and time-course controls:

    • Standardized inoculum preparation and verification

    • Multiple infection doses to establish dose-response relationships

    • Time-course experiments to capture dynamic interactions

    • Synchronized infection protocols to reduce variability

  • Statistical validation approaches:

    • Appropriate sample sizes based on power calculations

    • Multiple biological and technical replicates

    • Appropriate statistical tests based on data distribution

    • Blinded assessment of subjective outcomes

How should researchers interpret conflicting data regarding RnfE function across different experimental systems?

When faced with conflicting data about RnfE function, researchers should implement a systematic approach to interpretation that includes:

  • Methodological reconciliation framework:

    • Critically evaluate experimental conditions that may account for discrepancies:

      • Strain backgrounds (laboratory vs. clinical isolates)

      • Growth conditions and physiological state of bacteria

      • Experimental models (in vitro vs. ex vivo vs. in vivo)

      • Technical differences in assay execution

    • Create a standardized experimental pipeline to test hypotheses under uniform conditions

  • Integration of multi-omics data:

    • Generate complementary datasets using:

      • Transcriptomics (RNA-Seq)

      • Proteomics

      • Metabolomics

      • Fluxomics

    • Employ systems biology approaches to model RnfE function in different contexts

    • Identify conditional factors that modify RnfE activity

  • Contextual analysis matrix:

Experimental ContextObserved RnfE FunctionPotential Explanations for VariationValidation Approach
Laboratory growth mediaPrimary role in NADH oxidationAbundant alternative electron acceptorsMeasure activity with controlled electron donor/acceptor ratios
Anaerobic conditionsIon-pumping and energy conservationAltered redox balance and energetic demandsCompare membrane potential generation across oxygen conditions
Macrophage infection modelVirulence factor/stress responseHost-derived stressors affecting electron transportStress-specific reporter constructs to monitor RnfE activity
Animal infection modelHost-specific effectsDifferent host metabolic environmentsCross-species comparison with consistent bacterial strains
  • Mechanistic hypothesis refinement:

    • Develop testable hypotheses that could explain apparent contradictions

    • Design targeted experiments to directly test competing hypotheses

    • Employ genetic suppressor screens to identify contextual genetic interactions

  • Statistical meta-analysis:

    • Conduct formal meta-analysis of available data when sufficient studies exist

    • Weight evidence based on methodological rigor and reproducibility

    • Identify patterns and trends across seemingly contradictory results

  • Collaborative validation:

    • Engage multiple laboratories to replicate key experiments using standardized protocols

    • Exchange materials (strains, reagents) to minimize technical variables

    • Implement blind testing for critical experiments

This methodological framework enables researchers to systematically address conflicting data, potentially revealing context-dependent functions of RnfE that reconcile apparent contradictions while advancing understanding of this protein's multifaceted roles.

What statistical approaches are most appropriate for analyzing RnfE-related experimental data?

When analyzing experimental data related to RnfE function and impact, researchers should employ appropriate statistical methodologies based on experimental design and data characteristics:

  • Comparative studies (wild-type vs. mutant):

    • For normally distributed continuous data: Student's t-test (paired or unpaired) or ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For non-normally distributed data: Mann-Whitney U test, Kruskal-Wallis test

    • For categorical outcomes: Chi-square or Fisher's exact test

    • Statistical significance typically set at p < 0.05, with adjustment for multiple comparisons (e.g., Benjamini-Hochberg procedure)

  • Time-course experiments:

    • Repeated measures ANOVA

    • Mixed effects models to account for within-subject correlations

    • Area under the curve (AUC) analysis followed by appropriate comparison tests

    • Growth curve fitting with comparison of derived parameters

  • Dose-response relationships:

    • Non-linear regression to fit appropriate models (e.g., logistic, Michaelis-Menten)

    • Comparison of EC50/IC50 values with confidence intervals

    • ANOVA on regression parameters across experimental conditions

  • High-dimensional data analysis:

    • For transcriptomics: DESeq2 or edgeR with FDR correction

    • For proteomics: LIMMA or mixed-effects models with multiple testing correction

    • Pathway enrichment analysis using GSEA, DAVID, or similar tools

    • Network analysis to identify functional modules affected by RnfE

  • Sample size and power considerations:

    • A priori power analysis to determine required sample sizes

    • Typically aim for 80-90% power to detect biologically relevant effect sizes

    • Post-hoc power analysis to interpret negative results

    • Consider biological vs. technical replication needs

  • Data visualization approaches:

    • Box plots with individual data points for group comparisons

    • Heat maps for expression data with hierarchical clustering

    • Volcano plots for high-throughput data

    • Principal component analysis for dimension reduction and pattern identification

The following example illustrates a typical statistical analysis approach for RnfE functional data:

Implementing these statistical approaches ensures robust, reproducible analysis of RnfE-related experimental data, enabling confident interpretation of results and facilitating comparison across studies.

What are the most promising research directions for understanding RnfE's role in antimicrobial resistance?

Investigation of RnfE's potential involvement in antimicrobial resistance represents an important frontier, especially given the concerning rise of drug-resistant Salmonella choleraesuis strains . The following methodological approaches outline promising research directions:

  • Mechanistic studies of RnfE contribution to resistance:

    • Investigate whether electron transport via RnfE provides alternate metabolic pathways during antibiotic stress

    • Determine if RnfE activity affects membrane potential, thereby influencing uptake of antimicrobials

    • Assess whether RnfE-dependent energy production supports efflux pump activity

    • Examine potential interactions between RnfE function and stress response systems

  • Comparative genomics and transcriptomics approach:

    • Analyze rnfE sequence variations across drug-resistant and susceptible isolates

    • Conduct RNA-Seq to compare expression patterns in:

      • Antibiotic-treated vs. untreated bacteria

      • Wild-type vs. rnfE mutant strains under antibiotic stress

      • Clinical isolates with varying resistance profiles

    • Identify potential regulatory links between resistance determinants and RnfE expression

  • Experimental evolution studies:

    • Subject wild-type and rnfE mutant strains to gradual antibiotic exposure

    • Track development of resistance mechanisms in each genetic background

    • Sequence evolved strains to identify genetic adaptations

    • Conduct fitness cost analysis of resistance mutations in different genetic backgrounds

  • Small molecule modulator screening:

    • Develop high-throughput screening assays for RnfE activity

    • Screen for compounds that specifically inhibit RnfE function

    • Test identified inhibitors for synergistic effects with conventional antibiotics

    • Evaluate potential for RnfE inhibitors to prevent or reverse resistance development

  • Host-pathogen interaction under antibiotic pressure:

    • Investigate how antibiotics affect RnfE-dependent survival in macrophages

    • Determine if RnfE contributes to persistence during antibiotic treatment

    • Assess whether RnfE affects antibiotic efficacy in in vivo infection models

This methodological framework provides a comprehensive approach to understanding RnfE's potential contribution to antimicrobial resistance, potentially identifying novel strategies to combat drug-resistant Salmonella choleraesuis infections.

How might structural studies of RnfE advance our understanding of bacterial electron transport systems?

Advanced structural studies of RnfE hold significant potential for expanding our understanding of bacterial electron transport systems. The following methodological approaches outline key directions:

  • High-resolution structure determination:

    • Cryo-electron microscopy (cryo-EM) of purified RnfE alone and within the complete Rnf complex

    • X-ray crystallography of soluble domains or stabilized full-length protein

    • NMR studies of individual domains to capture dynamic features

    • Integrative structural biology combining multiple techniques with computational modeling

  • Structure-guided functional mapping:

    • Identification of critical residues in electron transfer pathways

    • Mapping of proton translocation channels

    • Characterization of cofactor binding sites

    • Delineation of protein-protein interaction interfaces with other Rnf components

  • Comparative structural analysis:

    • Comparison with related proteins from different bacterial species

    • Structural alignment with functionally analogous but evolutionarily distinct systems

    • Identification of conserved structural motifs across diverse electron transport proteins

    • Evolutionary analysis of structure-function relationships

  • Mechanistic insights from structural dynamics:

    • Molecular dynamics simulations to model conformational changes during electron transport

    • Time-resolved structural studies to capture transition states

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Site-directed spin labeling combined with EPR to measure conformational changes

  • Structure-based inhibitor design potential:

    • Identification of druggable pockets within the RnfE structure

    • Virtual screening of compound libraries against identified binding sites

    • Fragment-based drug discovery approaches

    • Structure-guided optimization of lead compounds

The structural information obtained through these approaches would provide unprecedented insights into:

  • The molecular mechanisms of ion-coupled electron transfer

  • Principles of membrane protein complex assembly

  • Evolutionary adaptations in bacterial bioenergetics

  • Potential targets for novel antimicrobial development targeting energy metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.