Recombinant Salmonella choleraesuis Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
frdC; SCH_4220; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: sec:SCH_4220

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical role of frdC in Salmonella choleraesuis metabolism?

Fumarate reductase subunit C (frdC) is a hydrophobic, membrane-associated component of the fumarate reductase complex in Salmonella. It facilitates anaerobic respiration by transferring electrons from quinones to fumarate, enabling the bacterium to generate ATP under low-oxygen conditions . This enzyme is critical for bacterial survival in oxygen-limited environments, such as during host colonization or intracellular persistence.

How is recombinant frdC produced for research purposes?

Recombinant frdC is typically expressed in heterologous hosts like E. coli using plasmid-based systems. The process involves:

  • Cloning: Amplification of the frdC gene from S. choleraesuis genomic DNA and insertion into expression vectors (e.g., pET or pGEX).

  • Induction: Use of inducers like IPTG or arabinose to trigger protein synthesis.

  • Purification: Affinity chromatography (e.g., His-tag or GST-tag systems) followed by refolding to restore activity .

What are the challenges in optimizing recombinant frdC production?

Key challenges include:

FactorImpact on ProductionMitigation Strategies
Protein MisfoldingAggregation, loss of activityUse of chaperones (e.g., GroEL/GroES) or slow induction at low temperatures (15–20°C) .
Low YieldInsufficient quantities for downstream applicationsOptimize plasmid copy number, codon usage, or switch to high-expression strains (e.g., BL21(DE3)) .
Membrane IntegrationfrdC requires membrane anchoringCo-expression with S. choleraesuis membrane components or use of lipid-detergent systems .

How can frdC be used as a vaccine antigen?

  • Immune Evasion: S. choleraesuis often shows restricted host range, limiting cross-protection.

  • Adjuvant Dependency: Requires co-administration with adjuvants (e.g., OMVs) to enhance mucosal immunity .

  • Delivery Platforms: Attenuated Salmonella vectors (e.g., ΔaroA or ΔsopB strains) can deliver frdC to lymphoid tissues, eliciting both humoral and cellular responses .

What methods assess the structural integrity of recombinant frdC?

Structural validation is critical for functional studies. Common approaches include:

  • Circular Dichroism (CD) Spectroscopy: Measures α-helix/β-sheet content to confirm proper folding .

  • Cryo-EM or X-ray Crystallography: Resolves membrane-embedded topology and quinone-binding sites .

  • Western Blotting: Detects post-translational modifications or tag retention (e.g., His-tag) .

How do conflicting data on frdC’s role in pathogenicity arise?

Discrepancies often stem from:

  • Strain-Specific Differences: S. choleraesuis isolates vary in virulence factors and plasmid content, altering metabolic dependencies .

  • Experimental Models: In vitro (e.g., broth cultures) vs. in vivo (e.g., mouse models) conditions may reveal divergent frdC expression patterns .

  • Omic Analysis Bias: Proteomic studies may underrepresent membrane proteins like frdC due to solubility challenges .

What are the key considerations for frdC-based diagnostic assays?

ParameterBest Practice
Antigen PurityUse affinity-purified frdC to minimize cross-reactivity with host proteins .
Detection MethodELISA with anti-frdC antibodies (e.g., polyclonal IgG) or Western blotting for specificity .
Sample TypeValidate assays for serum, fecal, or tissue samples to account for matrix effects .

How might frdC-targeted therapeutics be developed?

  • Metabolic Inhibition: Small-molecule inhibitors of fumarate reductase could disrupt anaerobic respiration.

  • CRISPR-Based Editing: Knockout of frdC in attenuated Salmonella vectors to enhance vaccine safety .

  • Biomarker Discovery: frdC antibodies as indicators of S. choleraesuis infection in swine or humans .

What future directions are critical for frdC research?

  • Structure-Function Mapping: Define frdC’s role in electron transport chains and redox balance .

  • Host-Pathogen Interactions: Investigate frdC’s contribution to intracellular survival in macrophages .

  • Multi-Omic Integration: Combine proteomic and metabolomic data to elucidate frdC’s regulatory networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.