Recombinant Salmonella choleraesuis Glutathione transport system permease protein gsiD (gsiD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella choleraesuis Glutathione Transport System Permease Protein gsiD

The Recombinant Salmonella choleraesuis Glutathione transport system permease protein gsiD is a crucial component of the glutathione transport system in bacteria. This protein plays a vital role in transporting glutathione across cell membranes, which is essential for maintaining cellular redox balance and protecting against oxidative stress. Glutathione is a tripeptide composed of glutamic acid, cysteine, and glycine, acting as a major antioxidant in cells.

Function and Importance of gsiD

The gsiD protein is part of the GsiABCD system, which is responsible for the uptake of glutathione from the extracellular environment into the cell. This system is energy-dependent, requiring ATP for its function. The gsiD protein specifically acts as a permease, facilitating the transport of glutathione across the inner membrane of the bacterial cell.

Protein ComponentFunction
gsiAATPase
gsiBPermease
gsiCPermease
gsiDPermease

The gsiD protein is essential for maintaining intracellular glutathione levels, which are critical for various cellular processes, including detoxification, antioxidant defense, and regulation of cellular redox status.

Research Findings on gsiD

Research on the gsiD protein has highlighted its importance in bacterial survival and adaptation under stress conditions. For example, in Cronobacter sakazakii, deletion of the gsiD gene significantly reduces desiccation tolerance by impairing glutathione uptake, leading to increased oxidative stress and decreased biofilm formation .

StrainDesiccation ToleranceGlutathione UptakeBiofilm Formation
Wild Type (WT)HighNormalNormal
ΔgsiDLowImpairedReduced
ComplementedRestoredRestoredRestored

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
gsiD; SCH_0846; Glutathione transport system permease protein GsiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
gsiD
Target Protein Sequence
MRLFNWRRQAILHAMPVVKPDQIRTPWREFWRRFRRQHVALVAGGFVLALILVAIFARWL TPYDAENYFDYDSLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAIIGT VLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAFA RLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASL SFLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPK IKG
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex GsiABCD involved in glutathione import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: sec:SCH_0846

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the gsiD gene and what is its role in bacterial physiology?

The gsiD gene encodes a component of the GsiABCD ATP-binding transporter complex that facilitates the transfer of glutathione from the extracellular to intracellular space in bacteria. This transport system plays a critical role in maintaining intracellular glutathione levels, which is essential for bacterial stress tolerance. GsiD specifically functions as the permease protein within this complex, facilitating the actual movement of glutathione across the cell membrane .

Functionally, gsiD contributes significantly to bacterial stress responses, particularly under desiccation conditions. Research has demonstrated that deletion of gsiD inhibits glutathione uptake, leading to decreased intracellular glutathione content and reduced desiccation tolerance. The gene has been identified in several bacterial species including Escherichia coli O157:H7, Shigella flexneri, and Salmonella Typhimurium .

How does the GsiABCD transport system function in bacteria?

The GsiABCD transporter is an ATP-binding cassette (ABC) transport system specifically evolved for glutathione transport. The complex consists of four components:

  • GsiA: ATP-binding protein that provides energy for transport

  • GsiB: Substrate-binding protein that recognizes glutathione

  • GsiC: Permease protein that forms part of the transmembrane channel

  • GsiD: Permease protein that forms part of the transmembrane channel

The system operates by recognizing and binding extracellular glutathione, then using ATP hydrolysis to drive conformational changes that transport glutathione across the membrane and into the cytoplasm. Experimental evidence confirms that deletion of gsiD significantly decreases the transport capability, as demonstrated by reduced intracellular glutathione content in mutant strains .

Why is Salmonella choleraesuis considered an effective vaccine vector?

Salmonella choleraesuis has several advantageous properties that make it an effective vaccine vector:

  • Mimicry of natural infection: Live attenuated Salmonella strains can mimic natural infections, stimulating robust immune responses .

  • Induction of comprehensive immunity: Recombinant S. choleraesuis can induce mucosal, humoral, and cellular immune responses simultaneously .

  • Delivery efficiency: The bacterium can efficiently deliver heterologous antigens to immune system components.

  • Regulated attenuation systems: Modern S. choleraesuis vectors incorporate regulated delayed attenuation and regulated delayed exogenous synthesis systems, enhancing safety while maintaining immunogenicity .

  • Targeted modification capabilities: Genes like sopB can be knocked out to reduce intestinal inflammatory responses without compromising vaccine efficacy .

In studies with recombinant S. choleraesuis expressing Pasteurella multocida PlpE protein, oral immunization induced stronger antigen-specific immune responses than inactivated vaccines, with survival rates of 80% versus 60% after challenge with virulent strains .

How can I construct a recombinant Salmonella choleraesuis strain expressing a foreign antigen?

Construction of recombinant S. choleraesuis expressing a foreign antigen typically follows this methodological approach:

  • Vector selection: Choose an appropriate plasmid vector compatible with Salmonella. Low-copy plasmids with balanced stability and expression levels are often preferred.

  • Antigen gene preparation: Optimize the foreign gene sequence for expression in Salmonella, considering codon usage and potential regulatory elements.

  • Cloning strategy: Insert the optimized gene into the vector, typically under control of a promoter that functions appropriately in Salmonella. Options include:

    • Constitutive promoters (e.g., PrpsM)

    • In vivo-inducible promoters (e.g., Pssb, PphoP)

    • Regulated expression systems

  • Transformation: Introduce the recombinant plasmid into attenuated S. choleraesuis through electroporation or chemical transformation methods.

  • Verification: Confirm correct insertion and expression through:

    • PCR and sequencing

    • Western blotting

    • Immunofluorescence

    • ELISA for secreted antigens

  • Stability testing: Assess plasmid stability over multiple generations in the absence of selective pressure.

For example, the construction of rSC0016(pS-PlpE) involved cloning the PlpE antigen gene into a plasmid with an appropriate secretion signal and then transforming this construct into the attenuated S. choleraesuis vector rSC0016 . This process created a stable recombinant strain capable of expressing and secreting the heterologous antigen in vivo.

What methods are recommended for evaluating immune responses induced by recombinant Salmonella vaccines?

A comprehensive evaluation of immune responses to recombinant Salmonella vaccines should include assessment of mucosal, humoral, and cellular immunity:

Mucosal Immunity Assessment:

  • Collection of mucosal secretions (intestinal lavage, bronchoalveolar lavage)

  • Quantification of secretory IgA by ELISA

  • Analysis of mucosal lymphocyte populations by flow cytometry

Humoral Immunity Assessment:

  • Serum collection at multiple timepoints post-immunization

  • Quantification of antigen-specific total IgG by ELISA

  • Isotype analysis (IgG1, IgG2a, IgG2b, IgG3) to determine Th1/Th2 bias

  • Functional antibody assays (neutralization, opsonization)

Cellular Immunity Assessment:

  • Isolation of splenocytes and lymph node cells

  • ELISpot assays for IFN-γ, IL-2, and IL-4 production

  • Cytokine profiling (Th1: IFN-γ, IL-2; Th2: IL-4, IL-5, IL-10)

  • Proliferation assays in response to antigen re-stimulation

  • Flow cytometric analysis of T cell subsets (CD4+, CD8+) and activation markers

Challenge Studies:

  • Protective efficacy against pathogen challenge

  • Bacterial or viral load reduction

  • Survival rate and time

  • Clinical score assessment

  • Histopathological examination

In research with rSC0016(pS-PlpE), immune evaluation showed significantly higher PlpE-specific mucosal, humoral, and mixed Th1/Th2 cellular responses compared to empty vector controls. After challenge, immunized mice showed an 80% survival rate versus 60% for inactivated vaccine groups .

Immune ParameterrSC0016(pS-PlpE)Inactivated VaccineEmpty Vector
Serum IgGHighModerateLow
Mucosal IgAHighLowNegligible
IFN-γ ProductionHighModerateLow
IL-4 ProductionModerateModerateLow
Survival Rate80%60%0%

How do different antigen localization strategies affect immune responses?

Antigen localization within recombinant Salmonella significantly impacts the type and magnitude of immune responses:

Cytoplasmic Expression:

  • Simplest expression strategy

  • Antigen released only upon bacterial lysis

  • Generally induces weaker immune responses

  • Example: Early HIV gp120 expression systems in Salmonella showed limited immunogenicity when the antigen was confined to the cytoplasm .

Periplasmic Expression:

  • Requires signal sequences for translocation

  • Provides better protection from cytoplasmic proteases

  • Generates moderate immune responses

  • Example: Truncated HIV-1 gp120 expressed in the bacterial periplasm induced robust CD4+ Th1 and Th2 responses after a single immunization .

Surface Display:

  • Utilizes bacterial outer membrane proteins as anchors

  • Maximizes antigen exposure to immune system

  • Often generates stronger antibody responses

  • Example: HIV-1 gp120 expressed on the Salmonella surface demonstrated significantly higher immunogenicity than cytoplasmic expression .

Secreted Expression:

  • Incorporates secretion signals for extracellular release

  • Optimizes antigen presentation to immune cells

  • Typically induces the strongest and most balanced immune responses

  • Example: Secreted HIV-1 antigens from recombinant Salmonella vectors elicited stronger T cell responses than those expressed cytoplasmically .

Research directly comparing these strategies has demonstrated that:

  • Surface-expressed > periplasmic > cytoplasmic for antibody responses

  • Secreted > surface-expressed > periplasmic > cytoplasmic for T cell responses

  • Secreted antigens typically generate the most balanced Th1/Th2 responses

How does deletion of gsiD affect bacterial stress responses beyond desiccation tolerance?

Deletion of the gsiD gene has multiple effects on bacterial physiology beyond reduced desiccation tolerance:

Oxidative Stress Response:
The glutathione transport system is integral to maintaining redox homeostasis. Research demonstrates that gsiD deletion strains show increased sensitivity to oxidative stress agents such as hydrogen peroxide and superoxide generators. This occurs because impaired glutathione transport reduces the cell's capacity to neutralize reactive oxygen species.

Osmotic Stress Tolerance:
Glutathione also functions as a compatible solute. Studies indicate that ΔgsiD mutants exhibit compromised growth in high-salt environments, suggesting that glutathione uptake contributes to osmoregulation.

Gene Expression Changes:
The gsiD deletion alters expression of multiple stress-response pathways:

  • Decreased expression of proline biosynthesis genes (proB, proA, proC)

  • Reduced expression of extracellular glutathione degradation gene ggt

  • Altered expression of oxidative stress response genes

Biofilm Formation:
Glutathione transport affects extracellular matrix composition and cell-surface properties. ΔgsiD strains typically show reduced biofilm formation capacity, which may be linked to altered cell permeability and surface characteristics.

Cell Membrane Integrity:
Impaired glutathione transport affects membrane lipid composition and fluidity. Experimental evidence indicates increased membrane permeability in gsiD mutants, potentially due to altered lipid peroxidation patterns.

These multifaceted effects highlight the importance of glutathione transport in general bacterial stress responses, extending well beyond simple desiccation tolerance.

What methodologies can be used to quantify changes in intracellular glutathione levels?

Accurate measurement of intracellular glutathione levels is critical for understanding gsiD function. Multiple complementary approaches are recommended:

Colorimetric Assays:

  • DTNB (Ellman's reagent) based assays measure total glutathione (GSH + GSSG)

  • Sample preparation: Bacterial cells are harvested, washed, and lysed using physical or chemical methods

  • Quantification against standard curves

  • Advantages: Simple, cost-effective

  • Limitations: Less specific, potential interference from other thiols

Enzymatic Recycling Assays:

  • Utilizes glutathione reductase to measure total glutathione

  • GSSG is specifically measured after derivatizing GSH

  • GSH calculated by subtraction (Total - GSSG)

  • Advantages: Differentiation between GSH and GSSG forms

  • Used in studies to monitor glutathione content changes after gsiD deletion

HPLC-Based Methods:

  • Separation of glutathione from other cellular components

  • Derivatization with fluorescent tags (e.g., monobromobimane)

  • Detection via fluorescence or UV absorbance

  • Advantages: High specificity and sensitivity

  • Applications: When precise discrimination between closely related thiols is required

Mass Spectrometry (LC-MS/MS):

  • Highly specific identification and quantification

  • Can detect glutathione adducts and metabolites

  • Advantages: Ultimate specificity, can track isotopically labeled glutathione

  • Applications: For comprehensive glutathione metabolomics studies

Real-time Monitoring:

  • Genetically encoded glutathione sensors (roGFP)

  • Non-invasive measurement of glutathione redox state

  • Advantages: Live-cell imaging, temporal resolution

  • Applications: Studying dynamic changes in glutathione levels

When evaluating the impact of gsiD deletion on glutathione transport, it is recommended to use multiple methodologies to ensure robust measurements. Research has shown that ΔgsiD strains exhibit significantly reduced intracellular glutathione content compared to wild-type strains when cultured in glutathione-supplemented media .

What complementary techniques should be used to confirm that phenotypic changes are specifically due to gsiD deletion?

Establishing a direct causal relationship between gsiD deletion and observed phenotypes requires multiple complementary techniques:

Genetic Complementation:

  • Reintroduce the wild-type gsiD gene on a plasmid or in the chromosome

  • Verify restoration of the wild-type phenotype

  • Include both constitutive and native promoter constructs

  • Example: Complemented strain (cpgsiD) showed restored glutathione uptake capacity and desiccation tolerance comparable to wild-type

Multiple Mutant Construction:

  • Create independent gsiD deletion mutants using different methodologies

  • Confirm consistent phenotypes across independently derived mutants

  • Generate partial deletions or point mutations in functional domains

Gene Expression Analysis:

  • RT-qPCR to confirm altered expression of gsiD and related genes

  • RNA-Seq to identify broader transcriptional changes

  • Validate key findings using reporter gene fusions

Protein Analysis:

  • Western blotting to confirm absence of GsiD protein

  • Proteomics to assess changes in global protein expression

  • Analysis of other GsiABCD complex components

Biochemical Characterization:

  • Direct measurement of glutathione transport in membrane vesicles

  • Isotope-labeled glutathione uptake assays

  • ATP hydrolysis assays to assess transporter function

Trans-Species Complementation:

  • Express gsiD homologs from related species

  • Assess functional conservation and restoration of phenotype

  • Identify critical domains through chimeric constructs

Control Experiments:

Experimental ApproachPurposeExample Result
Genetic ComplementationConfirm direct causalityRestored glutathione uptake in cpgsiD
Growth Curve AnalysisRule out growth defectsNo significant difference in ΔgsiD growth rate
Glutathione Transport AssayQuantify functional impact65% reduction in glutathione uptake in ΔgsiD
Stress Tolerance TestsAssess phenotypic consequences36.43% decrease in desiccation tolerance
Gene Expression AnalysisIdentify regulatory effectsReduced expression of proB/A/C and ggt genes

Research with ΔgsiD has effectively employed these complementary approaches, particularly genetic complementation with the cpgsiD strain, to verify that phenotypic changes are specifically attributable to gsiD deletion rather than secondary effects .

What factors determine the efficacy of Salmonella choleraesuis as a vector for heterologous antigen delivery?

Multiple interconnected factors influence the efficacy of S. choleraesuis as a vaccine vector:

Attenuation Strategy:

  • The degree and mechanism of attenuation affect persistence and immunogenicity

  • Regulated delayed attenuation systems optimize the balance between safety and efficacy

  • Example: The rSC0016 strain incorporates a regulated delayed attenuation system that maintains immunogenicity while ensuring safety

Antigen Expression Systems:

  • Promoter selection influences antigen expression timing and level

  • Codon optimization enhances translation efficiency

  • Secretion signals determine antigen localization

  • Example: Incorporating secretion signals for PlpE in rSC0016(pS-PlpE) enhanced immune recognition

Genetic Stability:

  • Plasmid versus chromosomal integration affects expression stability

  • Balanced metabolic burden prevents selection against antigen expression

  • Antibiotic resistance markers may be necessary for maintenance in laboratory settings but problematic for vaccine development

Host Factors:

  • Route of administration affects the type of immune response

  • Host genetic background influences immunogenicity

  • Pre-existing immunity to Salmonella may enhance or inhibit responses

  • Example: Oral inoculation of rSC0016(pS-PlpE) induces strong mucosal IgA responses

Antigen Properties:

  • Size, structure, and inherent immunogenicity of the heterologous antigen

  • Compatibility with Salmonella expression machinery

  • Potential toxicity to the bacterial vector

  • Example: PlpE from P. multocida is effectively expressed and induces protective immunity

Adjuvant Properties:

  • Co-expression of immunomodulatory molecules enhances responses

  • Modification of bacterial components can optimize adjuvant effects

  • Example: Deletion of sopB in rSC0016 reduces intestinal inflammation while maintaining adjuvant effects

Dose and Regimen:

  • Single versus multiple immunizations affects response magnitude

  • Prime-boost strategies may enhance immunity

  • Interval between doses influences memory cell development

  • Example: Two oral doses of rSC0016(pS-PlpE) induced robust protection (80% survival)

Research with rSC0016(pS-PlpE) demonstrated that optimal vector construction led to 80% protection against lethal challenge, outperforming traditional inactivated vaccines (60% protection) .

How can prime-boost strategies be optimized when using recombinant Salmonella vaccines?

Prime-boost vaccination strategies significantly enhance immune responses when using recombinant Salmonella vectors:

Homologous Prime-Boost:

  • Using the same recombinant Salmonella vector for both prime and boost

  • Advantages: Simplicity, consistent processing and presentation

  • Limitations: Potential anti-vector immunity may limit boost effectiveness

  • Optimization factors:

    • Interval between doses (typically 3-4 weeks optimal)

    • Dosage adjustments (same or escalating)

    • Route variations (e.g., oral prime, intranasal boost)

Heterologous Prime-Boost:

  • Using different delivery systems for prime and boost

  • Advantages: Circumvents anti-vector immunity, engages different immune pathways

  • Common combinations:

    • Salmonella prime + viral vector boost (enhances T cell responses)

    • Salmonella prime + protein subunit boost (enhances antibody responses)

    • DNA vaccine prime + Salmonella boost (balanced response)

  • Example: DNA vaccine priming followed by recombinant Salmonella boosting showed enhanced immune responses compared to either approach alone

Adjuvant Enhancement:

  • Incorporating molecular adjuvants in either prime or boost

  • Examples:

    • Co-expression of cytokines or co-stimulatory molecules

    • Use of cholera toxin derivatives

  • Research demonstrated that co-expression of cholera toxin catalytic domain (CTA1) with HIV gp120 in Salmonella-vectored DNA vaccines enhanced gp120-specific IgG responses over 1000-fold compared to vaccines without CTA1

Route Optimization:

  • Strategic combination of different immunization routes

  • Effective combinations:

    • Oral prime + intranasal boost (enhances respiratory and intestinal immunity)

    • Intranasal prime + oral boost (sequential mucosal induction)

    • Oral/intranasal prime + parenteral boost (mucosal + systemic coverage)

Optimal Timing Parameters:

  • Prime interval: Allow sufficient time for development of memory cells (3-4 weeks)

  • Boost interval: Short intervals may lead to interference

  • Multiple boosts: Diminishing returns after 2-3 boosts

The application of these optimized prime-boost strategies has demonstrated significant enhancement of both cellular and humoral responses to recombinant Salmonella-vectored antigens, with potential for 10-100 fold increases in antibody titers and significantly expanded T cell responses .

How do I address plasmid instability issues in recombinant Salmonella choleraesuis?

Plasmid instability is a common challenge in recombinant Salmonella research that can compromise experimental results and vaccine efficacy. Multiple strategies can address this issue:

Diagnostic Approaches:

  • Quantify plasmid retention over time:

    • Serial passaging without selective pressure

    • Plating on selective vs. non-selective media

    • Colony PCR screening for plasmid presence

    • Flow cytometry for reporter gene expression

  • Identify instability mechanisms:

    • Sequence analysis for mutations

    • Restriction analysis for rearrangements

    • Growth curve comparison (with/without plasmid)

    • Stress response assessment

Remediation Strategies:

  • Vector Modifications:

    • Use lower copy number plasmids to reduce metabolic burden

    • Incorporate balanced-lethal selection systems (e.g., asd complementation)

    • Implement post-segregational killing systems

    • Utilize chromosomal integration for critical genes

  • Expression Optimization:

    • Use tightly regulated inducible promoters

    • Implement in vivo-activated promoters

    • Reduce expression levels to minimize metabolic burden

    • Codon-optimize genes for improved translation efficiency

  • Culture Condition Adjustments:

    • Optimize growth temperature

    • Adjust media composition

    • Control oxygen levels

    • Minimize exposure to stressful conditions

  • Genetic Background Optimization:

    • Select compatible Salmonella strains

    • Engineer strains with reduced recombination capacity

    • Eliminate competing plasmids

    • Remove problematic mobile genetic elements

In research applications, a combination approach often yields the best results. For example, the development of rSC0016(pS-PlpE) likely involved optimization of vector systems to ensure stable expression of the heterologous PlpE antigen during in vivo colonization .

Stabilization StrategyMechanismApplication Example
Balanced-lethal selectionHost strain lacks essential gene complemented by plasmidasd-deleted host with asd+ plasmid
In vivo inducible promotersExpression only in relevant host environmentsPphoP activation in macrophages
Chromosomal integrationSingle-copy stable expressionattB/attP-based integration
Two-plasmid segregation systemsSeparating antigen and secretion componentsAntigen on high-copy, secretion on low-copy plasmid

How should apparent contradictions between in vitro and in vivo results be analyzed?

Discrepancies between in vitro and in vivo results are common in recombinant Salmonella research and require systematic investigation:

Common Discrepancy Patterns:

  • Expression Differences:

    • High expression in vitro but low in vivo

    • Stable plasmid retention in vitro but loss in vivo

    • Different antigen processing in vitro versus in vivo

  • Immune Response Variations:

    • Strong immune response in vitro but weak protection in vivo

    • Cellular responses detected in vitro but not in vivo

    • Different cytokine profiles between systems

Methodological Analysis Framework:

  • Systematic Comparison:

    • Create a detailed matrix comparing all experimental conditions

    • Identify key differences in techniques, reagents, and environmental factors

    • Evaluate temporal considerations (acute vs. chronic responses)

  • Bridging Studies:

    • Develop intermediate models (ex vivo systems, organoids)

    • Use explant cultures from immunized animals

    • Isolate cells from in vivo experiments for in vitro testing

  • Environmental Factor Analysis:

    • Examine microbiome influences

    • Consider tissue-specific differences in antigen presentation

    • Evaluate systemic versus localized responses

  • Immune System Complexity:

    • Assess involvement of innate immunity (missing in many in vitro systems)

    • Evaluate regulatory T cell influences (often absent in vitro)

    • Consider antibody effector functions that require in vivo components

Resolution Strategies:

  • Refine In Vitro Models:

    • Incorporate relevant tissue-specific cells

    • Add appropriate immune cell populations

    • Adjust oxygen levels to match in vivo conditions

    • Include relevant microbiome components

  • Enhance In Vivo Monitoring:

    • Implement in vivo imaging techniques

    • Use reporter gene systems for real-time monitoring

    • Perform sequential sampling at multiple timepoints

    • Employ single-cell analysis of isolated cells

  • Statistical Integration:

    • Use multivariate analysis to identify correlative factors

    • Develop predictive models integrating in vitro and in vivo datasets

    • Implement machine learning approaches to identify hidden patterns

Research with recombinant Salmonella vaccines has shown that in vitro expression levels don't always predict in vivo immunogenicity. For example, HIV-1 gp120 expression levels in culture may not correlate directly with in vivo immune responses, highlighting the need for comprehensive in vivo assessment regardless of promising in vitro results .

What statistical approaches are most appropriate for analyzing protection data from Salmonella vaccine studies?

Proper statistical analysis is critical for interpreting protection data from recombinant Salmonella vaccine studies:

Primary Outcome Measures:

  • Survival Analysis:

    • Kaplan-Meier survival curves with log-rank test for between-group comparisons

    • Cox proportional hazards models for multivariable analysis

    • Time-to-event analysis for disease onset

    • Example: Comparison of 80% survival in rSC0016(pS-PlpE) group versus 60% in inactivated vaccine group

  • Bacterial/Viral Load Analysis:

    • Log transformation of microbial counts (CFU/PFU)

    • ANOVA or Kruskal-Wallis for multiple group comparisons

    • Mixed effects models for repeated measures

    • Area-under-curve analysis for clearance kinetics

  • Immune Correlates Analysis:

    • Pearson/Spearman correlation between immune parameters and protection

    • Receiver operating characteristic (ROC) analysis to identify protective thresholds

    • Principal component analysis to identify patterns across multiple immune parameters

    • Machine learning approaches for complex immune signature identification

Advanced Statistical Considerations:

  • Sample Size and Power Calculations:

    • A priori power analysis based on expected effect size

    • Sequential analysis methods for ethical animal use

    • Adaptive design consideration for refinement of experiments

  • Multiple Comparison Adjustments:

    • Bonferroni correction for conservative approach

    • False discovery rate (FDR) control for exploratory studies

    • Hierarchical testing procedures for related outcomes

  • Missing Data Handling:

    • Multiple imputation methods

    • Sensitivity analysis to examine impact of missing data

    • Pattern-mixture models for non-random missing data

  • Specialized Approaches:

    • Bayesian methods for incorporating prior knowledge

    • Meta-analysis techniques for combining multiple studies

    • Cluster analysis for identifying responder/non-responder patterns

Reporting Recommendations:

  • Complete Data Presentation:

    • Individual data points alongside group summaries

    • Appropriate error bars (standard deviation vs. standard error)

    • Clear description of sample sizes throughout experiments

  • Effect Size Reporting:

    • Include confidence intervals

    • Report actual p-values rather than significance thresholds

    • Include measures of practical significance (e.g., percent protection)

  • Transparent Exclusion Criteria:

    • Pre-specified criteria for data exclusion

    • Clear documentation of any post-hoc analyses

    • Separate exploratory from confirmatory analyses

In the rSC0016(pS-PlpE) vaccine study, researchers appropriately used survival analysis to demonstrate the 80% protection rate, while also incorporating immunological correlates through statistical analysis of antibody titers, cytokine levels, and histopathological scores .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.