Recombinant Salmonella choleraesuis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization

Recombinant PlsY is a 203-amino acid protein encoded by the plsY gene (SCH_3154 locus) in S. choleraesuis strain SC-B67 . Key properties include:

PropertyDetail
Molecular FunctionCatalyzes the acylation of glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA), the first committed step in phospholipid biosynthesis .
EC Numbers2.3.1.15 (G3P acyltransferase), 2.3.1.n5 (lysophosphatidic acid synthase) .
Expression SystemProduced in Escherichia coli with an N-terminal His tag for purification .
Purity>90% as determined by SDS-PAGE .
StorageStable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

The enzyme’s structure includes conserved domains critical for substrate binding, such as residues involved in G3P and acyl-CoA interactions . Its sequence (MSAIAPGMILFAYLCGS...KWTKLKKKRQKD) aligns with homologs in other Salmonella serovars, reflecting evolutionary conservation .

Functional Insights

PlsY is essential for membrane biogenesis, enabling bacterial survival under stress conditions. Key findings include:

  • Catalytic Role: Unlike E. coli PlsB, which uses acyl-ACP or acyl-CoA donors, PlsY in Salmonella primarily utilizes acyl-phosphate substrates, a distinction critical for its adaptation to host environments .

  • Regulation: Expression is modulated by fatty acid availability, as seen in related Vibrio cholerae homologs, where FadR transcriptionally represses plsB until fatty acid levels increase .

  • Complementation Studies: Heterologous expression of plsY rescues G3P auxotrophy in E. coli mutants, confirming functional equivalence to native enzymes .

3.1. Vaccine Development

Attenuated S. choleraesuis strains expressing recombinant proteins like PlsY serve as vectors for oral vaccines. These strains exploit Salmonella’s ability to induce mucosal and systemic immunity . For example:

  • Vector Stability: Plasmids encoding heterologous antigens (e.g., plpE, saoA) remain stable in S. choleraesuis for >50 generations, enabling sustained antigen delivery .

  • Immune Response: Recombinant strains trigger mixed Th1/Th2 responses and enhance survival rates in murine models (e.g., 80% survival against Pasteurella multocida) .

3.2. Enzymatic Studies

  • Mechanistic Studies: Purified PlsY is used to elucidate lipid biosynthesis pathways, particularly in antibiotic-resistant strains .

  • Diagnostic Tools: Commercial ELISA kits (e.g., CSB-CF685152SBF) utilize recombinant PlsY for antibody detection in research settings .

Industrial and Clinical Relevance

  • Antibiotic Targets: As a membrane synthesis enzyme, PlsY is a potential target for novel antimicrobials, especially against multidrug-resistant Salmonella .

  • Biotechnology: High-yield expression systems (e.g., pYA3493 plasmid in E. coli) enable scalable production for structural and functional studies .

Challenges and Future Directions

  • Host Adaptation: While S. choleraesuis PlsY shares functional homology with V. cholerae PlsB, structural differences may affect inhibitor design .

  • Vaccine Optimization: Balancing attenuation and immunogenicity remains critical; recent strains (e.g., rSC0016) address reactogenicity by deleting inflammatory genes like sopB .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; ygiH; SCH_3154; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor but not acyl-PO(4).
Database Links

KEGG: sec:SCH_3154

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Salmonella choleraesuis?

Glycerol-3-phosphate acyltransferase (plsY) in Salmonella choleraesuis is a 203-amino acid membrane protein that catalyzes a critical step in bacterial phospholipid biosynthesis. It functions by transferring acyl groups to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA), which is a key intermediate in glycerophospholipid synthesis. plsY works alongside plsX in a pathway for LPA generation, with plsX providing the acyl-phosphate donor that plsY utilizes for the acylation reaction . This enzyme is also known by several synonyms including ygiH, SCH_3154, G3P acyltransferase, GPAT, Lysophosphatidic acid synthase, and LPA synthase .

How does plsY differ from other acyltransferases in bacterial phospholipid synthesis?

plsY belongs to a distinct family of acyltransferases that utilizes acyl-phosphate as a substrate rather than acyl-CoA or acyl-ACP used by other acyltransferases like PlsB. While PlsB is the major enzymatic route for LPA generation in phospholipid synthesis in many bacteria, plsY functions in coordination with plsX, which generates the acyl-phosphate substrate from acyl-ACP . Interestingly, while single plsY or plsX mutants are viable, double mutants exhibit synthetic lethality, suggesting that these enzymes have functions beyond their canonical roles in the traditional synthetic pathway . This dual-enzyme system represents an alternative pathway for initiating phospholipid synthesis in bacteria.

What are the optimal conditions for expressing recombinant Salmonella choleraesuis plsY in E. coli?

The optimal expression of recombinant Salmonella choleraesuis plsY in E. coli requires careful consideration of several parameters. For effective expression, E. coli BL21(DE3) or similar strains are typically employed as expression hosts. Expression should be conducted using vectors containing strong promoters like T7 and including an N-terminal His-tag for purification purposes . The expression is optimally induced at mid-log phase (OD600 of 0.6-0.8) using IPTG concentrations between 0.1-0.5 mM, with induction temperatures of 16-22°C for 16-20 hours to enhance proper membrane protein folding and reduce inclusion body formation.

Since plsY is a membrane protein, using specialized E. coli strains like C41(DE3) or C43(DE3) that are designed for membrane protein expression can significantly improve yields. Additionally, supplementing the growth media with 0.2-0.5% glucose during the initial growth phase helps regulate basal expression before induction.

What purification strategies yield the highest purity and activity for recombinant plsY?

For high-purity, active recombinant plsY, a multi-step purification strategy is recommended:

  • Membrane Fraction Isolation: After cell lysis using a French press or sonication, separate the membrane fraction by ultracentrifugation (100,000 × g for 1 hour).

  • Detergent Solubilization: Solubilize the membrane fraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration or n-octyl-β-D-glucopyranoside (OG) at 2% concentration.

  • Immobilized Metal Affinity Chromatography (IMAC): Purify the His-tagged protein using Ni-NTA resin with a step gradient of imidazole (20-250 mM) .

  • Size Exclusion Chromatography (SEC): Further purify using gel filtration to remove aggregates and obtain homogeneous protein preparations.

The purified protein should be maintained in a buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, and 10% glycerol to preserve activity. SDS-PAGE analysis should confirm purity greater than 90% . Activity should be measured immediately after purification using a G3P acyltransferase assay.

How can researchers effectively reconstitute lyophilized recombinant plsY while maintaining its enzymatic activity?

To effectively reconstitute lyophilized recombinant plsY while preserving its enzymatic activity:

  • Initial Preparation: Briefly centrifuge the vial before opening to bring contents to the bottom .

  • Reconstitution Solution: Dissolve the lyophilized protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Stabilization: Add glycerol to a final concentration of 5-50% (50% being optimal) to protect the protein from freeze-thaw damage .

  • Gentle Mixing: Use gentle rotation or inversion rather than vortexing to avoid protein denaturation.

  • Membrane Protein Considerations: For functional studies, consider reconstituting the protein into liposomes composed of E. coli polar lipid extracts to provide a native-like membrane environment.

  • Storage: Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles and store at -20°C/-80°C for long-term storage, or at 4°C for up to one week for working solutions .

  • Activity Verification: After reconstitution, verify activity using a standardized G3P acyltransferase assay measuring the conversion of G3P to LPA.

What assays can be used to measure plsY enzymatic activity in vitro?

Several assays can be employed to measure plsY enzymatic activity in vitro:

  • Radiometric Assay: Using radiolabeled substrates (14C or 3H-labeled acyl-phosphate and unlabeled G3P), measure the formation of radiolabeled LPA. After reaction completion, extract lipids using chloroform/methanol, separate by thin-layer chromatography, and quantify radioactivity.

  • Coupled Enzymatic Assay: Monitor the release of inorganic phosphate during the acyltransferase reaction using colorimetric methods such as malachite green assay.

  • HPLC-Based Assay: Quantify LPA production by high-performance liquid chromatography with evaporative light scattering detection or mass spectrometry.

  • Fluorescence-Based Assay: Use fluorescently labeled G3P analogs to monitor product formation by changes in fluorescence properties.

For reliable activity measurements, use this reaction mixture:

  • 50 mM Tris-HCl (pH 7.5)

  • 10 mM MgCl2

  • 100 mM NaCl

  • 0.1% Triton X-100

  • 100 μM G3P

  • 50-100 μM acyl-phosphate

  • 1-5 μg purified plsY enzyme

Incubate the reaction at 37°C for 10-30 minutes and terminate by adding chloroform/methanol (2:1, v/v).

How does plsY interact with plsX in the glycerophospholipid synthesis pathway, and what methods can detect this interaction?

plsY and plsX work in a coordinated pathway wherein plsX converts acyl-ACP to acyl-phosphate, which is then used by plsY as a substrate to acylate G3P, forming LPA . This functional interaction is critical, as evidenced by the synthetic lethality of plsX and plsY double mutants despite the viability of single mutants .

Methods to detect and characterize this interaction include:

  • Bacterial Two-Hybrid System: Modified for membrane proteins to detect protein-protein interactions in vivo.

  • Co-Immunoprecipitation: Using antibodies against one protein to pull down interaction partners.

  • FRET (Förster Resonance Energy Transfer): Tagging plsX and plsY with appropriate fluorophores to detect proximity-based energy transfer.

  • Split Reporter Assays: Fusing complementary fragments of a reporter protein to plsX and plsY to detect interactions through reconstituted activity.

  • Metabolic Channeling Experiments: Analyzing the kinetics of G3P acylation in systems with varying levels of plsX and plsY to detect evidence of substrate channeling.

Research has shown that while direct physical interaction between plsX and plsY may be transient, their functional coupling is essential for maintaining proper cellular lipid homeostasis and preventing toxic accumulation of acyl-ACP intermediates .

What is the relationship between plsY activity and G3P levels in bacterial cells?

The relationship between plsY activity and G3P levels is complex and bidirectional:

  • G3P as a Substrate: G3P serves as a direct substrate for plsY in the acyltransferase reaction, making enzyme activity dependent on G3P availability .

  • Rescue of Synthetic Lethality: Increased G3P concentrations can rescue the synthetic lethality of ΔplsXY double mutants, suggesting that heightened G3P levels can compensate for deficiencies in the plsX/plsY pathway .

  • Regulatory Feedback: While single plsX or plsY mutants don't show significant changes in G3P pools, the combined loss creates an imbalance requiring G3P supplementation .

This relationship is supported by experimental evidence showing that:

  • Overexpression of G3P-producing enzymes like GlpK or GpsA rescues ΔplsXY synthetic lethality

  • Direct supplementation with 0.2% G3P, but not glycerol, suppresses the lethal phenotype of ΔplsXY mutants

  • Heightened G3P levels likely push LPA synthesis through alternative pathways when plsX/plsY function is compromised

ConditionG3P LevelCell Viability
Wild-typeNormalViable
ΔplsXNormalViable
ΔplsYNormalViable
ΔplsXYNormalLethal
ΔplsXY + GlpK/GpsA overexpressionIncreasedViable
ΔplsXY + 0.2% G3P supplementationIncreasedViable
ΔplsXY + 0.2% glycerol supplementationNormalLethal

This table summarizes the relationship between G3P levels and cell viability under different genetic backgrounds, highlighting the critical role of G3P in plsY function .

How can recombinant plsY be utilized for antimicrobial drug discovery?

Recombinant plsY represents a promising target for antimicrobial drug discovery due to its essential role in bacterial phospholipid biosynthesis. Researchers can utilize recombinant plsY in the following drug discovery approaches:

  • High-Throughput Screening (HTS): Develop miniaturized plsY activity assays suitable for screening compound libraries. This typically involves measuring inhibition of plsY-mediated G3P acylation using fluorescence-based or colorimetric readouts.

  • Structure-Based Drug Design: Using solved or predicted structures of plsY, conduct in silico screening to identify compounds that may bind to the active site or allosteric sites. The membrane topology of plsY presents unique pocket opportunities for selective inhibitor binding.

  • Fragment-Based Drug Discovery: Screen molecular fragments for binding to plsY using biophysical methods like surface plasmon resonance (SPR) or thermal shift assays, then elaborate these fragments into more potent inhibitors.

  • Differential Targeting Strategy: Exploit structural or functional differences between bacterial plsY and mammalian G3P acyltransferases to develop selectively toxic antimicrobials.

  • Combination Therapy Approaches: Investigate synergistic effects between plsY inhibitors and existing antibiotics, particularly those affecting cell wall synthesis or membrane integrity.

The synthetic lethality observed between plsX and plsY suggests that dual targeting of both enzymes might provide a strategy to overcome potential resistance mechanisms .

How can recombinant plsY be incorporated into attenuated Salmonella vaccine development?

The incorporation of recombinant plsY into attenuated Salmonella vaccine development represents an innovative approach with several strategic advantages:

  • Dual-Purpose Attenuation Strategy: Modifying plsY expression or activity could serve as an attenuation mechanism for Salmonella vectors while maintaining immunogenicity. Partial inhibition of plsY would affect membrane composition without causing complete lethality.

  • Recombinant Expression Platform: Attenuated Salmonella Choleraesuis strains like rSC0016 have been demonstrated as effective delivery vectors for heterologous antigens . This system could be adapted to express and deliver:

    • Modified versions of plsY as immunogens

    • Fusion proteins incorporating plsY epitopes with other antigens

    • Regulatory elements responsive to plsY metabolic pathways

  • Immunomodulatory Properties: Changes in bacterial phospholipid composition mediated by plsY manipulation may enhance immune responses through altered pathogen-associated molecular pattern (PAMP) presentation.

Data from related systems shows promising results. For example, a recombinant attenuated S. Choleraesuis vector expressing the heterologous antigen PlpE demonstrated:

  • Efficient antigen delivery in vivo

  • Enhanced mucosal, humoral, and mixed Th1/Th2 cellular immune responses

  • 80% survival rate in challenged animals compared to 60% for inactivated vaccines

Vaccine StrategyImmune ResponseProtection RateAdvantages
Inactivated VaccinePrimarily humoral60%Established safety profile
Empty Vector rSC0016Limited response<50%Basic attenuation platform
rSC0016 with heterologous antigenMucosal, humoral, and cellular (Th1/Th2)80%Comprehensive immunity
Theoretical plsY-based strategyPredicted broad spectrumTo be determinedNovel membrane-focused immunity

This table compares immune response profiles for different vaccine strategies based on attenuated Salmonella platforms .

What are common challenges in expressing and purifying recombinant plsY and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant plsY due to its nature as a membrane protein:

  • Low Expression Yields:

    • Cause: Toxicity of membrane protein overexpression to host cells

    • Solution: Use lower induction temperatures (16-20°C), reduce inducer concentration, use specialized strains like C41(DE3), or employ tightly controlled expression systems

  • Protein Misfolding and Aggregation:

    • Cause: Improper membrane integration, hydrophobic domain exposure

    • Solution: Incorporate fusion partners like MBP or SUMO, optimize detergent types and concentrations during purification, consider co-expression with bacterial chaperones

  • Loss of Activity During Purification:

    • Cause: Detergent-induced conformational changes, loss of essential lipids

    • Solution: Screen multiple detergents (DDM, OG, LDAO), include lipids during purification, minimize time between solubilization and final storage

  • Poor Reconstitution After Lyophilization:

    • Cause: Irreversible structural changes during freeze-drying

    • Solution: Add protective agents like trehalose (present in recommended storage buffer at 6%) , optimize reconstitution conditions, consider storing as frozen aliquots rather than lyophilized powder

  • Inconsistent Activity Assays:

    • Cause: Variability in lipid environment, substrate accessibility

    • Solution: Standardize lipid composition in assays, ensure detergent concentration is consistent, validate activity with multiple assay methods

How can researchers effectively analyze the function of plsY in the context of synthetic lethality with plsX?

Investigating plsY function in the context of its synthetic lethal relationship with plsX requires specialized approaches:

  • Conditional Expression Systems:

    • Implement tetracycline-responsive or arabinose-inducible promoters to control plsY/plsX expression levels

    • Create depletion strains where chromosomal copies are deleted and plasmid-based expression can be regulated

    • This allows observation of phenotypes as protein levels gradually decrease

  • Metabolomic Analysis:

    • Monitor changes in phospholipid profiles, acyl-ACP levels, and G3P pools during plsY/plsX depletion

    • Use LC-MS or other sensitive detection methods to quantify metabolic intermediates

    • Correlate metabolite changes with viability loss to identify critical thresholds

  • Suppressor Screens:

    • Identify genetic suppressors of plsX/plsY synthetic lethality

    • Analyze how increased G3P levels rescue the double mutant phenotype

    • Screen for mutations that redirect metabolic flux to compensate for plsX/plsY loss

  • Complementation Studies:

    • Express plsB or other acyltransferases to determine functional equivalence

    • Test whether overexpression of G3P-producing enzymes like GlpK or GpsA rescues lethality

    • Evaluate cross-species complementation to identify conserved versus species-specific functions

  • Biochemical Bypass Experiments:

    • Supplement growth media with phospholipid precursors like G3P or LPA

    • Determine minimum concentrations required for rescue

    • Analyze membrane composition changes in rescued cells

What controls and validation methods are essential when studying recombinant plsY in experimental systems?

When studying recombinant plsY, implementing appropriate controls and validation methods is crucial for reliable results:

  • Protein Quality Controls:

    • Purity Assessment: SDS-PAGE analysis should confirm >90% purity

    • Activity Benchmarking: Compare specific activity of each preparation to established standards

    • Thermal Stability Analysis: Circular dichroism or differential scanning fluorimetry to confirm proper folding

    • Mass Spectrometry Validation: Confirm protein identity and detect any post-translational modifications

  • Enzymatic Activity Controls:

    • Negative Controls: Heat-inactivated enzyme, catalytically inactive mutants (site-directed mutagenesis)

    • Substrate Specificity Validation: Test activity with various acyl-chain lengths and G3P analogs

    • Inhibitor Controls: Known inhibitors or competitive substrates to validate assay specificity

    • Time-Course and Concentration-Dependent Activity: Establish linear range of assay

  • Genetic System Validation:

    • Complementation Controls: Verify that wild-type plsY expression rescues phenotypes of mutants

    • Marker-Free Mutations: Ensure phenotypes aren't due to polar effects on adjacent genes

    • Inducible Systems Calibration: Validate that expression systems provide appropriate protein levels

  • Metabolic Context Controls:

    • Lipid Profiling: Monitor changes in phospholipid composition when plsY activity is altered

    • Growth Condition Standardization: Control carbon source availability, which affects G3P pools

    • Co-factor Dependency Tests: Verify magnesium or other ion requirements for activity

  • Technical Validation Methods:

    • Multiple Assay Approaches: Validate findings using orthogonal methods

    • Reproducibility Assessment: Biological and technical replicates with statistical analysis

    • Batch-to-Batch Consistency: Establish quality control metrics for protein preparations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.