Recombinant Salmonella choleraesuis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

**Introduction to Recombinant Salmonella choleraesuis Large-Conductance Mechanosensitive Channel (MscL)

The recombinant Salmonella choleraesuis large-conductance mechanosensitive channel (MscL) is a bacterial membrane protein engineered for study in heterologous systems. MscL functions as an emergency osmolyte-release valve, opening under extreme membrane tension to prevent cellular lysis during osmotic shock . In S. choleraesuis, a pathogen linked to systemic infections in humans and swine, MscL’s role extends to antibiotic resistance and biofilm formation . The recombinant version is produced in E. coli as a His-tagged protein (1–137 aa) for structural and functional analysis .

Gating Mechanism

MscL gates through a “lipid-moves-first” model, where lateral bilayer tension displaces lipids from hydrophobic pockets between TM helices, triggering conformational changes . Mutations like L89W (or M94 in E. coli) at the TM pocket entrance stabilize subconducting states, reducing activation thresholds .

MutationEffect on GatingSource
L89WDestabilizes closed state; lowers activation pressure
M94Analogous to L89W; enhances pore hydration in MD simulations

Antibiotic Interactions

MscL facilitates uptake of aminoglycosides (e.g., dihydrostreptomycin) and release of potassium/glutamate, contributing to antibiotic resistance . In Actinobacillus pleuropneumoniae, mscL deletion reduces antibiotic tolerance .

AntibioticRole in MscL ActivitySource
DihydrostreptomycinBinds near TM pockets; induces partial channel opening
AminoglycosidesUtilized MscL for cytoplasmic entry in E. coli

Recombinant Production

The S. choleraesuis MscL is expressed as a His-tagged fusion protein in E. coli, purified via affinity chromatography, and reconstituted into liposomes for electrophysiology .

ParameterValueSource
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% Trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL) with glycerol

Potential Applications

  1. Antimicrobial Target: MscL’s absence in eukaryotes makes it a candidate for novel antibiotics .

  2. Vaccine Development: S. choleraesuis strains are used as vectors for heterologous antigen delivery, though MscL-specific vaccines are not yet developed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SCH_3346; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLISGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links

KEGG: sec:SCH_3346

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.