Recombinant Salmonella choleraesuis Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Overview

The recombinant Salmonella choleraesuis Lipid A export ATP-binding/permease protein MsbA (msbA) is a membrane-bound ATP-binding cassette (ABC) transporter critical for lipid A and lipopolysaccharide (LPS) transport in Gram-negative bacteria. This recombinant version is engineered for research and biotechnological applications, retaining the native protein’s structural and functional properties. MsbA facilitates the translocation of lipid A (the toxic component of LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane, a process essential for outer membrane biogenesis and bacterial viability .

2.2. Functional Role in Lipid A Transport

MsbA acts as a lipid flippase, moving lipid A and phospholipids across the inner membrane. Key findings include:

  • Essentiality: Knockout strains exhibit lethal lipid export defects, causing inner membrane reduplications .

  • Substrate Specificity: Activates ATP hydrolysis in response to lipid A, particularly Kdo₂-lipid A .

  • Interaction with LPS Biosynthesis: Coordinated with LptA-G proteins for outer membrane assembly .

3.1. Production Parameters

The recombinant MsbA is typically expressed in E. coli with an N-terminal His tag for purification:

ParameterValueSource
Expression SystemE. coli
Protein LengthFull-length (1–582 aa)
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer with 6% trehalose (pH 8.0)

4.2. Biotechnological and Therapeutic Uses

  • Vaccine Development: Salmonella strains with modified MsbA (e.g., ΔmsbB) are used as attenuated vaccine vectors to reduce LPS toxicity while retaining antigen delivery .

  • Lipid A Detoxification: MsbA mutants alter lipid A acylation, reducing TLR4 activation and inflammatory responses .

Comparative Analysis with Homologs

PropertySalmonella choleraesuis MsbAE. coli MsbAVibrio cholerae MsbA
ATPase ActivityModerateModerateHigh
Resolution2.8 Å5.5 Å5.5 Å
Lipid A BindingConfirmedConfirmedConfirmed
Source

Challenges and Future Directions

  • Membrane Stability: Recombinant MsbA requires stabilization with detergents (e.g., maltoside) for structural studies .

  • Therapeutic Targeting: Inhibitors of MsbA could disrupt LPS export, but off-target effects on eukaryotic ABC transporters remain a concern .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
msbA; SCH_0941; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
msbA
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ
Uniprot No.

Target Background

Function

MsbA is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the energy for this process.

Database Links

KEGG: sec:SCH_0941

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of MsbA in Salmonella species?

MsbA functions as an essential ATP-binding cassette (ABC) transporter in Gram-negative bacteria, including Salmonella species. Its primary role is transporting lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane. This translocation is crucial for proper outer membrane biogenesis, as lipid A serves as the membrane anchor for LPS, a major component of the bacterial outer membrane. The protein plays a critical role in maintaining cellular envelope integrity, which is essential for bacterial survival and pathogenicity .

The translocation mechanism involves a series of conformational changes that facilitate the "flipping" of these hydrophobic molecules across the membrane bilayer. This transport function is particularly significant because lipid A is synthesized on the cytoplasmic side but must function on the periplasmic side of the inner membrane, making MsbA an essential mediator in this process .

How conserved is the msbA gene across different Salmonella serovars?

The msbA gene shows high conservation across different Salmonella serovars, reflecting its essential function in bacterial survival. Genomic analyses of Salmonella enterica strains reveal that msbA belongs to the core genome, with sequence conservation typically exceeding 95% at the nucleotide level. Within the extensive genomic diversity documented in collections like the University of Warwick/University College Cork (UoWUCC) 10K project, which encompasses strains from 73 different countries isolated between 1891-2010, msbA remains notably conserved .

When examining hierarchical clusters based on core genome multilocus sequence typing (cgMLST), msbA sequences cluster according to phylogenetic lineages rather than geographical origin. This pattern indicates that selective pressure maintains functional consistency of this essential transporter despite the substantial genomic diversity observed across the Salmonella enterica species .

What role does MsbA play in Salmonella pathogenesis and virulence?

MsbA's contribution to Salmonella pathogenesis is multifaceted and centers on its essential role in lipopolysaccharide transport. By facilitating the proper assembly of the outer membrane, MsbA indirectly influences several virulence-associated properties:

  • Membrane Integrity: Functional MsbA ensures correct lipid A and LPS placement, maintaining membrane barrier function critical for survival in host environments.

  • Antibiotic Resistance: The properly assembled outer membrane provides intrinsic resistance to various antimicrobial compounds, including host defense peptides.

  • Immune Evasion: Complete LPS structures with O-antigen, dependent on MsbA transport, can shield bacteria from complement-mediated killing and affect recognition by host pattern recognition receptors.

  • Vaccine Development Applications: In recombinant attenuated Salmonella vaccine (RASV) design, modifications affecting lipid A transport through MsbA can be engineered to reduce inflammatory responses without compromising vaccine efficacy .

In experimental systems, regulated expression of genes affecting lipid A synthesis and export, such as through the P BAD activator-promoter system replacing upstream regulatory elements, has been used to create strains with attenuated virulence suitable for vaccine development .

What structural features enable MsbA to transport lipid A across the membrane?

The crystal structure of MsbA from Salmonella typhimurium, resolved at 2.8-Å resolution, reveals several key structural features that facilitate lipid A transport:

  • Transmembrane Portal: The inward-facing conformation displays a large amplitude opening in the transmembrane portal, which likely serves as the entry point for lipid A to move from its site of synthesis into the protein-enclosed transport pathway .

  • Nucleotide-Binding Domains (NBDs): These domains bind and hydrolyze ATP, providing the energy required for the conformational changes that drive the transport cycle.

  • Transmembrane Helices: The arrangement of these helices creates a cavity that can accommodate the bulky lipid A molecule.

  • Periplasmic Surface Cleft: Electron density attributed to lipid A has been observed near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting this region may function as an exit site .

The structural evidence supports a "trap and flip" model for lipid A transport, wherein the substrate enters through the large portal in the inward-facing conformation, becomes enclosed within the transmembrane cavity, and is then "flipped" to the periplasmic side as MsbA undergoes ATP-driven conformational changes .

How does the structure of Salmonella MsbA compare to homologous transporters in other bacteria?

The structure of Salmonella typhimurium MsbA (PDB ID: 6BL6) reveals both conserved features and unique adaptations compared to homologous ABC transporters:

The comparative analysis shows that while the core structural elements and transport mechanism are conserved across bacterial species, subtle differences in the transmembrane domains likely reflect adaptations to slight variations in lipid A structure between different bacterial species. These structural insights provide valuable information for designing species-specific inhibitors that could target pathogenic bacteria while sparing commensal microbes .

What conformational changes does MsbA undergo during the lipid A transport cycle?

MsbA undergoes a series of ATP-dependent conformational changes during the lipid A transport cycle. Based on structural and biochemical studies of MsbA from Salmonella and related organisms, the transport cycle includes the following major conformational states:

  • Inward-facing (nucleotide-free): This conformation, captured in the crystal structure of Salmonella typhimurium MsbA (PDB: 6BL6), features a large opening toward the cytoplasm that allows lipid A to enter the transmembrane cavity .

  • Occluded state: Upon ATP binding to the nucleotide-binding domains (NBDs), the transporter transitions to an occluded state where the substrate is enclosed within the transmembrane domain.

  • Outward-facing: ATP hydrolysis drives further conformational changes, resulting in an outward-facing state that exposes the substrate to the periplasmic space. In this state, electron density attributed to lipid A has been observed near an outer surface cleft at the periplasmic ends of the transmembrane helices .

  • Reset to inward-facing: Following substrate release and phosphate dissociation, the transporter returns to the inward-facing conformation, ready for another cycle.

These conformational changes constitute the "trap and flip" mechanism, by which MsbA facilitates the energetically unfavorable movement of the large, amphipathic lipid A molecule across the hydrophobic core of the membrane bilayer .

What are the most effective methods for expressing and purifying recombinant Salmonella MsbA?

Successful expression and purification of recombinant Salmonella MsbA requires specialized techniques for handling membrane proteins. Based on methodologies employed in structural studies, the following approach has proven effective:

  • Expression System:

    • Host: E. coli C41(DE3) or C43(DE3) strains optimized for membrane protein expression

    • Vector: pET-based with a C-terminal His6-tag or Twin-Strep-tag

    • Induction: IPTG concentration of 0.1-0.5 mM at reduced temperature (18-20°C) for 16-18 hours

  • Membrane Preparation:

    • Cell disruption via homogenization or sonication in buffer containing 50 mM Tris-HCl pH 7.5, 100 mM NaCl, and protease inhibitors

    • Sequential centrifugation: low-speed (10,000×g) to remove cell debris followed by high-speed (100,000×g) to collect membranes

  • Solubilization:

    • Critical step: Use of facial amphiphiles as stabilizing agents during solubilization, which has been shown to maintain MsbA in a functional state suitable for crystallization

    • Detergent: n-Dodecyl-β-D-maltopyranoside (DDM) at 1-2% w/v in membrane resuspension buffer

    • Incubation: 1-2 hours at 4°C with gentle rotation

  • Purification:

    • Affinity chromatography: Ni-NTA or Strep-Tactin resin

    • Size exclusion chromatography: Superdex 200 in buffer containing 0.02-0.05% DDM

    • Quality control: Assess protein homogeneity by dynamic light scattering and activity by ATPase assays

This optimized protocol has been crucial for obtaining stable, homogeneous MsbA suitable for structural studies, as demonstrated in the successful crystallization of Salmonella typhimurium MsbA with bound lipid A .

How can researchers measure MsbA transport activity in vitro?

Researchers can assess MsbA transport activity in vitro using several complementary approaches, each providing insights into different aspects of the transport mechanism:

  • ATPase Activity Assays:

    • Malachite green phosphate detection assay: Measures Pi release from ATP hydrolysis

    • Coupled enzyme assay: Uses pyruvate kinase and lactate dehydrogenase to couple ATP regeneration to NADH oxidation

    • Advantages: Simple, quantitative, high-throughput compatible

    • Limitations: Measures only ATP hydrolysis, not actual substrate transport

  • Direct Transport Assays:

    • Fluorescently labeled lipid A analogs: Monitor movement from inner to outer leaflet of reconstituted liposomes

    • Radioactively labeled substrates: Track [³H]- or [¹⁴C]-labeled lipid A transport across membranes

    • Protocol requires:

      • Reconstitution of purified MsbA into proteoliposomes

      • Addition of labeled substrate to the interior or exterior compartment

      • Separation of transported vs. non-transported substrate via filtration or centrifugation

      • Quantification by fluorescence spectroscopy or scintillation counting

  • Conformational Change Monitoring:

    • EPR spectroscopy: Using site-directed spin labeling at strategic positions to monitor conformational changes during transport cycle

    • FRET-based approaches: Labeling pairs of residues to track distance changes during substrate transport

These methodologies have been instrumental in elucidating the "trap and flip" model of lipid A transport by MsbA, as evidenced in structural studies of Salmonella typhimurium MsbA .

What genetic systems are available for studying msbA function in Salmonella?

Several genetic systems have been developed for studying msbA function in Salmonella, each offering distinct advantages for different research questions:

  • Conditional Expression Systems:

    • Arabinose-inducible P BAD promoter replacement: The P BAD activator-promoter system has been successfully used to control expression of genes in the lipopolysaccharide synthesis pathway in Salmonella

    • Tetracycline-responsive elements: Allow tight regulation of msbA expression levels

    • Temperature-sensitive alleles: Enable conditional functionality at permissive versus non-permissive temperatures

  • Genomic Integration Approaches:

    • λ Red recombination system: Allows precise chromosomal modifications including point mutations, deletions, and promoter replacements

    • CRISPR-Cas9 genome editing: Enables scarless genomic modifications to study specific residues or domains

  • Reporter Systems:

    • Transcriptional fusions: msbA promoter fused to reporter genes (lacZ, gfp) to study regulation

    • Translational fusions: MsbA protein fused to tags (GFP, mCherry) to monitor localization

    • Protein-fragment complementation assays: Split-reporter systems to study MsbA interactions

  • Complementation Systems:

    • Since msbA is essential, complementation approaches using plasmid-expressed variants under native or inducible promoters allow study of mutant alleles

These genetic tools have been particularly valuable in vaccine development research, where regulated expression of genes affecting lipid A synthesis and export has been engineered to create attenuated Salmonella strains with modified virulence properties suitable for recombinant attenuated Salmonella vaccines (RASVs) .

How can MsbA be targeted in recombinant attenuated Salmonella vaccine (RASV) development?

MsbA can be strategically targeted in recombinant attenuated Salmonella vaccine (RASV) development through several sophisticated approaches:

  • Regulated Delayed Attenuation:

    • By placing msbA under the control of the arabinose-inducible P BAD promoter, researchers can create strains with normal MsbA function during in vitro growth (when arabinose is present) but attenuated function in vivo (when arabinose is absent)

    • This approach allows the vaccine strain to effectively colonize lymphoid tissues initially, then become attenuated, enhancing safety while maintaining immunogenicity

  • Lipid A Modification Systems:

    • Engineering strains with altered msbA expression or function can modify lipid A transport, which in turn affects outer membrane composition and immunostimulatory properties

    • Modified lipid A structures can reduce inflammatory responses without compromising vaccine efficacy

    • Targeted mutations in MsbA can create strains with specific immunomodulatory properties

  • Antigen Delivery Optimization:

    • MsbA-dependent outer membrane vesicle (OMV) production can be enhanced through specific mutations, creating a system for delivering vaccine antigens

    • OMVs derived from Salmonella strains with engineered MsbA expression provide a natural adjuvant effect due to their pathogen-associated molecular patterns

  • Multi-target Attenuation:

    • Combining msbA regulation with modifications to other genes involved in lipopolysaccharide synthesis, such as rfaH and rfc under P BAD control, creates robust attenuation systems with reduced reversion risk

This multi-faceted approach to MsbA targeting has proven valuable in creating safe and effective vaccine candidates that provide appropriate balance between attenuation and immunogenic capacity .

What role does MsbA play in antimicrobial resistance development in Salmonella?

MsbA contributes to antimicrobial resistance in Salmonella through several mechanisms, making it an important research target for understanding and combating drug resistance:

  • Intrinsic Resistance Mechanisms:

    • As the transporter responsible for lipid A and LPS translocation, MsbA is essential for outer membrane integrity, which forms the first barrier against many antibiotics

    • Proper LPS assembly, dependent on MsbA function, contributes to impermeability against hydrophobic antibiotics and larger antimicrobial molecules

  • Active Efflux Capacity:

    • Although MsbA's primary substrate is lipid A, studies suggest it may contribute to efflux of certain hydrophobic compounds, potentially including some antibiotics

    • This non-specific transport ability is characteristic of many ABC transporters and may contribute to multidrug resistance phenotypes

  • Adaptive Responses:

    • Salmonella strains under antibiotic pressure have been observed to upregulate msbA expression, suggesting its importance in adaptive resistance

    • Altered MsbA function can affect membrane fluidity and permeability, indirectly influencing the effectiveness of membrane-targeting antibiotics

  • Target for Resistance Reversal:

    • Inhibition of MsbA can potentially sensitize resistant Salmonella to antibiotics by compromising membrane integrity

    • The crystal structure of Salmonella typhimurium MsbA provides molecular targets for developing inhibitors that could serve as resistance-breaking adjuvants

The structural insights from the 2.8-Å resolution crystal structure of MsbA from Salmonella typhimurium offer valuable information for rational drug design targeting this transporter, potentially leading to new approaches for overcoming antimicrobial resistance .

How does MsbA interact with the broader lipopolysaccharide biosynthesis pathway?

MsbA functions as a critical checkpoint in the lipopolysaccharide (LPS) biosynthesis pathway, interacting with multiple components to ensure proper outer membrane assembly:

  • Pathway Position and Coordination:

    • MsbA acts downstream of the Raetz pathway enzymes that synthesize lipid A in the cytoplasm

    • It functions upstream of the Lpt (lipopolysaccharide transport) pathway that moves LPS from the inner membrane to the outer membrane

    • This sequential positioning makes MsbA a key regulatory point controlling LPS flow

  • Substrate Recognition Specificity:

    • MsbA preferentially recognizes and transports lipid A molecules with specific structural features

    • The crystal structure of Salmonella typhimurium MsbA reveals a binding pocket that accommodates the unique architecture of lipid A

    • The large amplitude opening in the transmembrane portal allows lipid A to enter from its site of synthesis directly into the transport pathway

  • Regulatory Interactions:

    • MsbA activity is influenced by interactions with:

      • LpxK, which adds the 4′-phosphate to lipid A precursors

      • WaaA (KdtA), which adds Kdo residues to lipid A

      • RfaH, a transcriptional antiterminator that reduces polarity of operons required for LPS production

  • Integration with O-antigen Synthesis:

    • Mutations affecting O-antigen synthesis genes like rfc (encoding O-antigen polymerase) and rfaH have downstream effects on MsbA function

    • The P BAD promoter system used to regulate these genes demonstrates their interconnected roles in the LPS biosynthesis network

The integration of MsbA within this complex pathway makes it an excellent target for attenuated vaccine development, as demonstrated by the successful engineering of regulated delayed attenuation systems in recombinant attenuated Salmonella vaccines (RASVs) .

What are common pitfalls in recombinant expression of MsbA and how can they be addressed?

Recombinant expression of MsbA presents several challenges common to membrane proteins, with specific solutions developed through structural biology research:

ChallengeManifestationSolution
Toxicity to expression hostGrowth arrest, plasmid instabilityUse C41/C43(DE3) E. coli strains specifically evolved for membrane protein expression; employ tight expression control with repressible promoters
Protein misfoldingInclusion body formation, low activityLower induction temperature (16-20°C); reduce IPTG concentration (0.1-0.2 mM); add glycerol (5-10%) to growth media
Poor membrane integrationLow yield in membrane fractionOptimize signal sequences; use milder detergents for extraction; employ fusion partners like MBP
Detergent-induced instabilityAggregation, loss of activity over timeUse facial amphiphiles as stabilizing agents during solubilization ; screen detergent panels (DDM, LMNG, GDN); add lipids during purification
Heterogeneous lipid A bindingStructural heterogeneityPerform additional purification steps; consider lipid exchange protocols; use specific lipid A analogs for homogeneity
Limited shelf-lifeActivity loss during storageAdd glycerol (10-20%); store at higher protein concentrations; consider flash-freezing in small aliquots

The successful crystallization of Salmonella typhimurium MsbA at 2.8-Å resolution was achieved by addressing these challenges, particularly through the innovative use of stabilizing facial amphiphiles during the solubilization process, demonstrating that these technical obstacles can be overcome with appropriate methodological adjustments .

How can researchers troubleshoot issues in lipid A transport assays with MsbA?

Lipid A transport assays present unique challenges due to the hydrophobic nature of the substrate and the complexity of membrane-based systems. Here are methodological approaches to common issues:

  • Poor Signal-to-Noise Ratio:

    • Issue: High background or weak signal in fluorescence-based assays

    • Troubleshooting:

      • Increase MsbA:lipid ratio in proteoliposomes (typically 1:200 w/w protein:lipid)

      • Optimize fluorescent lipid A analog concentration

      • Employ quenching agents on the trans side of the membrane

      • Increase sensitivity through longer wavelength fluorophores with better signal-to-noise characteristics

  • Inconsistent Reconstitution:

    • Issue: Variable protein incorporation into liposomes

    • Troubleshooting:

      • Standardize proteoliposome preparation using consistent detergent removal rates

      • Verify MsbA orientation using protease protection assays

      • Use density gradient centrifugation to purify properly formed proteoliposomes

      • Confirm protein incorporation by freeze-fracture electron microscopy

  • Baseline ATPase Activity Issues:

    • Issue: High baseline activity or poor stimulation by lipid A

    • Troubleshooting:

      • Remove tightly bound endogenous lipids using additional purification steps

      • Screen detergent conditions that preserve native-like lipid interactions

      • Include specific lipids (PE, PG, cardiolipin) that support MsbA activity

      • Verify protein quality by thermostability assays (differential scanning fluorimetry)

  • Transport Rate Quantification:

    • Issue: Difficulty establishing true initial rates

    • Troubleshooting:

      • Implement rapid sampling techniques with automated quenching

      • Develop continuous real-time assays using environment-sensitive fluorophores

      • Account for substrate depletion effects in kinetic models

      • Use reconstituted systems with defined internal volumes

These methodological refinements have been essential for elucidating the "trap and flip" model of lipid A transport supported by structural studies of Salmonella typhimurium MsbA .

What are the challenges in determining structure-function relationships in MsbA?

Determining structure-function relationships in MsbA presents several methodological challenges requiring specialized experimental approaches:

  • Capturing Transient Conformational States:

    • Challenge: MsbA undergoes rapid conformational changes during the transport cycle

    • Solutions:

      • Use of ATP analogs (AMP-PNP, ATPγS) to trap specific states

      • Introduction of specific mutations that stabilize intermediate conformations

      • Application of time-resolved spectroscopic techniques (TR-FRET, smFRET)

      • Computational molecular dynamics simulations to model transition states between crystal structures

  • Correlating Structural Features with Transport Activity:

    • Challenge: Difficult to directly connect structural elements to specific transport steps

    • Solutions:

      • Systematic mutagenesis of residues lining the transmembrane cavity

      • Cross-linking studies to restrict conformational flexibility at key positions

      • EPR distance measurements to track domain movements during transport

      • Structure-guided fluorescent labeling at strategic positions for real-time conformational monitoring

  • Lipid A-Binding Site Identification:

    • Challenge: The large, flexible lipid A molecule creates diffuse electron density

    • Solutions:

      • Co-crystallization with lipid A analogs containing heavy atoms or specific chemical modifications

      • Hydrogen-deuterium exchange mass spectrometry to identify protected regions upon substrate binding

      • Computational docking and molecular dynamics simulations with explicit membrane environments

      • Photo-affinity labeling with lipid A derivatives to identify interaction sites

  • Membrane Environment Reconstitution:

    • Challenge: Crystal structures may not reflect native membrane environment

    • Solutions:

      • Complementary cryo-EM studies in nanodiscs or other membrane mimetics

      • Comparison of structures obtained in different detergent and lipid environments

      • Functional assays in reconstituted membranes with varying lipid compositions

      • Native mass spectrometry to identify co-purifying lipids that may be functionally relevant

The crystal structure of MsbA from Salmonella typhimurium at 2.8-Å resolution provided significant insights by addressing many of these challenges, particularly through the use of stabilizing facial amphiphiles during solubilization and co-crystallization with lipid A .

What are the most promising approaches for developing MsbA inhibitors as potential antimicrobials?

The development of MsbA inhibitors as antimicrobials represents an attractive strategy due to the essential nature of this transporter in Gram-negative bacteria. Based on structural and functional insights, several promising approaches emerge:

  • Structure-Based Drug Design:

    • The 2.8-Å resolution crystal structure of Salmonella typhimurium MsbA provides an excellent template for rational drug design

    • Virtual screening campaigns targeting:

      • The nucleotide-binding domains to identify competitive ATP antagonists

      • The lipid A binding pocket in the transmembrane domain

      • Interface regions critical for conformational changes

    • Fragment-based approaches to identify chemical scaffolds with high ligand efficiency

  • Allosteric Inhibition Strategies:

    • Targeting sites distant from the ATP or lipid A binding pockets that prevent conformational changes

    • Development of compounds that stabilize the inward-facing conformation, preventing completion of the transport cycle

    • Exploiting the large amplitude opening in the transmembrane portal observed in the crystal structure

  • Natural Product Exploration:

    • Screening microbial extracts for MsbA inhibitors, particularly from organisms that compete with Gram-negative bacteria in natural environments

    • Investigating compounds from medicinal plants with traditional uses against bacterial infections

    • Repurposing existing ABC transporter inhibitors with structural modifications to enhance MsbA specificity

  • Peptide-Based Approaches:

    • Design of peptide mimetics based on MsbA transmembrane segments that disrupt proper assembly or function

    • Development of cyclic peptides that interfere with critical protein-protein or protein-lipid interactions

    • Phage display screening to identify peptides with high affinity for specific MsbA conformations

The detailed structural insights into the lipid A transport pathway in MsbA provide crucial information for each of these approaches, potentially leading to novel antimicrobials targeting this essential bacterial transporter .

How might MsbA research contribute to novel vaccine adjuvant development?

MsbA research offers several promising pathways for novel vaccine adjuvant development, leveraging its role in lipid A transport and outer membrane formation:

  • Engineered Outer Membrane Vesicles (OMVs):

    • Modified MsbA expression or function can alter OMV composition and production in Salmonella

    • These engineered OMVs can serve as natural adjuvants with tailored immunostimulatory properties

    • Research directions include:

      • Modulating MsbA activity to control OMV size and membrane composition

      • Engineering MsbA variants that increase incorporation of specific immunostimulatory lipids into OMVs

      • Creating temperature-sensitive MsbA mutants for controlled OMV production

  • Lipid A Variants with Optimized Adjuvant Properties:

    • MsbA structural studies provide insights for engineering Salmonella strains producing modified lipid A structures

    • These modified structures can be designed to:

      • Retain adjuvant activity while reducing pyrogenicity

      • Target specific Toll-like receptors (TLRs) to direct particular immune responses

      • Enhance antigen presentation through dendritic cell activation

  • Recombinant Protein Adjuvant Systems:

    • MsbA itself, particularly immunogenic epitopes, could be incorporated into adjuvant formulations

    • Fusion proteins combining MsbA epitopes with antigens could create self-adjuvanting vaccines

    • Nanoparticles displaying MsbA-derived peptides might enhance immune recognition

  • Genetic Adjuvant Strategies:

    • Regulated expression systems developed for msbA in RASVs provide templates for creating live vector vaccines with built-in adjuvant properties

    • The P BAD activator-promoter approach used to regulate genes affecting lipid A synthesis offers a model for controlling adjuvant effects in vivo

These approaches build on the understanding that modification of lipid A can reduce inflammatory responses without compromising vaccine efficacy, providing a foundation for developing next-generation adjuvants with optimized immunostimulatory profiles .

What genomic approaches could advance our understanding of MsbA evolution and specialization across bacterial species?

Advanced genomic approaches offer powerful tools for understanding MsbA evolution and specialization across bacterial species, with several promising research directions:

  • Comparative Genomics and Phylogenetic Analysis:

    • Leveraging large-scale genomic databases like the University of Warwick/University College Cork (UoWUCC) 10K project, which includes Salmonella strains from 73 countries isolated over more than a century (1891-2010)

    • Methodological approaches:

      • Construction of phylogenetic trees based on msbA sequences across diverse bacterial species

      • Mapping structural and functional domains to identify conserved vs. variable regions

      • Correlation of msbA sequence variations with bacterial ecological niches and host ranges

      • Identification of selection signatures using dN/dS ratio analysis

  • Population Genomics of Salmonella MsbA:

    • Analysis of msbA variations within the hierarchical clustering framework developed for Salmonella genomic analysis:

      • Examination at different resolution levels (HC400, HC900, HC2000 clusters)

      • Correlation with serovar distribution and host adaptation

      • Identification of msbA variants associated with specific ecological niches or geographic regions

  • Experimental Evolution and Genome Editing:

    • Directed evolution experiments applying selective pressures related to MsbA function

    • CRISPR-based approaches to:

      • Introduce specific msbA variants from different bacterial species into Salmonella

      • Create chimeric MsbA proteins to identify species-specific functional domains

      • Conduct high-throughput mutagenesis screens of msbA combined with deep sequencing

  • Structural Genomics Integration:

    • Combining genomic data with structural information from the 2.8-Å resolution crystal structure :

      • Mapping sequence variations onto the 3D structure to identify functionally significant polymorphisms

      • Predicting effects of natural variations on lipid A binding and transport efficiency

      • Guiding the design of species-specific inhibitors based on unique structural features

These genomic approaches, especially when integrated with structural and functional data, offer promising avenues for understanding how MsbA has evolved and specialized across bacterial species, potentially leading to targeted antimicrobial strategies .

What are the optimal conditions for studying MsbA-lipid A interactions in vitro?

Studying MsbA-lipid A interactions in vitro requires carefully optimized experimental conditions to maintain protein stability while allowing meaningful substrate binding and transport measurements:

  • Purification and Stability Considerations:

    • Buffer optimization: 20-50 mM Tris-HCl or HEPES pH 7.4-8.0, 100-300 mM NaCl, 5-10% glycerol

    • Critical detergent selection: n-Dodecyl-β-D-maltopyranoside (DDM) at 0.02-0.05% or Lauryl Maltose Neopentyl Glycol (LMNG) at 0.01%

    • Stabilizing additives: 1-5 mM MgCl₂, 1 mM DTT or TCEP

    • Key innovation: Use of facial amphiphiles as stabilizing agents during solubilization, which has proven successful in obtaining stable MsbA suitable for crystallization with lipid A

  • Lipid A Preparation and Delivery:

    • Source considerations: Synthetic versus extracted lipid A (synthetic offers greater homogeneity)

    • Solubilization methods: Stock preparation in DMSO (≤5% final concentration) or complexation with methyl-β-cyclodextrin

    • Concentration range: 1-50 μM for binding studies, ensuring subsaturating to saturating conditions

    • Fluorescent/radioactive labeling: Strategic placement of tags to minimize interference with binding

  • Interaction Analysis Techniques:

    • Biophysical methods:

      • Isothermal titration calorimetry (ITC): 5-30 μM MsbA, 50-500 μM lipid A, 25°C

      • Microscale thermophoresis (MST): 10-50 nM fluorescently labeled MsbA, 0.1-500 μM lipid A

      • Surface plasmon resonance (SPR): MsbA immobilized on Ni-NTA chips, lipid A flowed at 0.1-100 μM

    • Spectroscopic approaches:

      • Intrinsic tryptophan fluorescence quenching: 0.1-1 μM MsbA, 0.1-100 μM lipid A

      • FRET with labeled lipid A analogs: 10-100 nM labeled MsbA, 10-1000 nM labeled lipid A

  • Reconstituted Systems:

    • Proteoliposome composition: E. coli polar lipid extract with 10-30% POPE at 10-20 mg/ml

    • Protein:lipid ratio: 1:200 to 1:1000 (w/w)

    • Size control: Extrusion through 100-200 nm filters for uniform vesicles

    • Internal buffer: 20 mM HEPES pH 7.4, 100 mM KCl; external buffer: same plus 5 mM MgCl₂

These optimized conditions have enabled detailed structural and functional studies of MsbA-lipid A interactions, supporting the "trap and flip" model of lipid A transport revealed in the crystal structure of Salmonella typhimurium MsbA .

What data analysis approaches are most effective for interpreting MsbA structural dynamics?

Interpreting MsbA structural dynamics requires sophisticated data analysis approaches that can capture the complex conformational changes occurring during the transport cycle:

  • Molecular Dynamics (MD) Simulation Analysis:

    • All-atom MD simulations in explicit membrane environments (100-1000 ns)

    • Analysis workflows:

      • Principal Component Analysis (PCA) to identify major collective motions

      • Dynamic Cross-Correlation Matrices (DCCM) to detect correlated domain movements

      • Normal Mode Analysis (NMA) to characterize intrinsic flexibility patterns

      • Free energy calculations using enhanced sampling techniques (umbrella sampling, metadynamics)

    • Implementation details:

      • GROMACS, NAMD, or AMBER software packages with CHARMM36 or AMBER lipid force fields

      • Analysis using Bio3D, MDAnalysis, or in-house Python/R scripts

      • Visualization with PyMOL, VMD, or UCSF Chimera

  • Electron Paramagnetic Resonance (EPR) Data Analysis:

    • Distance distribution extraction from DEER/PELDOR spectra

    • Methodological approach:

      • Tikhonov regularization with L-curve criterion for optimal regularization parameter

      • Model-based fitting using Gaussian or Rice distributions

      • Ensemble analysis comparing experimental distance distributions with those from structural models

      • Integration with computational models through ensemble refinement

  • Single-Molecule FRET Analysis:

    • Hidden Markov Modeling (HMM) for state identification and transition kinetics

    • Technical considerations:

      • Correction for donor/acceptor blinking and photobleaching

      • FRET efficiency conversion to distances using appropriate Förster radius calibration

      • Dwell time analysis to extract kinetic parameters of conformational changes

      • Integration of data from multiple FRET pairs to construct global structural models

  • X-ray Crystallography and Cryo-EM Data Integration:

    • Comparative analysis between different structural states:

      • Vector-based domain movement analysis using DynDom or similar tools

      • Difference distance matrix analysis to identify regions of conformational change

      • Morphing between conformational states to model transition pathways

      • Flexible fitting of high-resolution crystal structures into lower-resolution cryo-EM maps

These analytical approaches have been instrumental in elucidating the structural dynamics of MsbA, particularly in understanding how the large amplitude opening in the transmembrane portal facilitates lipid A entry and how conformational changes drive the "trap and flip" transport mechanism revealed in the crystal structure of Salmonella typhimurium MsbA .

What computational approaches can predict the impact of mutations on MsbA function?

Advanced computational methods offer powerful tools for predicting how mutations affect MsbA structure and function, providing guidance for experimental design:

  • Structure-Based Prediction Methods:

    • Molecular Dynamics (MD) Free Energy Calculations:

      • Alchemical free energy perturbation (FEP) or thermodynamic integration (TI) to calculate ΔΔG of mutation

      • Implementation details: 10-20 lambda windows, 10-100 ns per window, GROMACS or AMBER software

      • Accuracy metrics: Typically achieves 1-2 kcal/mol accuracy for well-parameterized systems

    • Empirical Force Field Methods:

      • FoldX, Rosetta, and PBSA-based scoring methods

      • Protocol: Multiple independent runs with structure relaxation between calculations

      • Integration: Ensemble-based approaches using multiple conformational states of MsbA

  • Sequence-Based Prediction Approaches:

    • Deep Learning Methods:

      • Neural network architectures (CNN, LSTM) trained on ABC transporter mutation datasets

      • Feature engineering: Incorporation of evolutionary conservation, physicochemical properties

      • Performance metrics: Area under ROC curve >0.85 for mutation impact classification

    • Evolutionary Analysis:

      • Coevolutionary coupling analysis using direct coupling analysis (DCA) or related methods

      • Statistical coupling analysis (SCA) to identify functionally important networks

      • Sequence conservation analysis from large-scale genomic datasets like the UoWUCC 10K collection

  • Combined Approaches:

    • Consensus Prediction Frameworks:

      • Integration of structural, sequence, and experimental data through weighted scoring

      • Metapredictors combining outputs from multiple individual methods

      • Confidence metrics based on prediction consistency across methods

    • Network-Based Analyses:

      • Residue interaction networks constructed from crystallographic data

      • Graph-theoretical analysis to identify critical nodes (residues) for structural integrity

      • Perturbation propagation models to predict allosteric effects of mutations

  • Validation and Benchmarking:

    • Cross-validation protocols using known MsbA mutations with characterized phenotypes

    • Confusion matrix analysis (sensitivity, specificity, precision, F1 score)

    • Comparison with experimental data from thermal stability assays, ATPase activity measurements

    • Iterative refinement based on experimental feedback

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.