Recombinant Salmonella choleraesuis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role of LspA

Lipoprotein Processing Mechanism

  • LspA cleaves the signal peptide of prolipoproteins after their N-terminal cysteine residue (the "lipobox"), enabling lipid anchoring to the bacterial membrane .

  • This step is essential for virulence, host cell invasion, and immunogenicity in pathogenic bacteria .

Key Features

  • Contains four transmembrane domains and conserved catalytic residues (e.g., Asp102, Asp129 in Bacillus subtilis) .

  • Inhibited by globomycin, a peptide antibiotic that blocks SPase II activity .

3.1. Transcriptional Dynamics

Studies on R. typhi lspA reveal differential expression during bacterial growth phases:

Growth PhaselspA Expression LevellepB (SPase I) ExpressionRole
PreinfectionHighHigherPrepares bacteria for host entry
8–48 h postinfectionIncreasingHighestSupports intracellular replication
120 h postinfectionDecliningDecliningHost cell lysis phase

Data sourced from R. typhi models .

3.2. Functional Validation

  • Globomycin Resistance: Overexpression of R. typhi lspA in E. coli conferred increased resistance to globomycin, confirming its enzymatic activity .

  • Genetic Complementation: R. typhi lspA partially restored growth in a temperature-sensitive E. coli lspA mutant (Y815), demonstrating cross-species functionality despite low sequence identity (22%) .

4.1. Attenuated S. choleraesuis Vectors

Recombinant S. choleraesuis strains engineered for regulated antigen delivery leverage lipoprotein processing for immunogenicity:

  • Strain rSC0016: Delivers Pasteurella multocida PlpE lipoprotein, inducing mucosal, humoral, and cellular immunity in mice .

  • Strain rSC0012: Attenuated via fur mutation, reduces inflammatory responses while maintaining antigen presentation efficiency .

4.2. Key Findings

Vaccine StrainAntigen DeliveredImmune ResponseSurvival Rate Post-Challenge
rSC0016(pS-PlpE)PlpE lipoproteinMixed Th1/Th2, mucosal IgA80%
rSC0018(pQK664)Choleraesuis O-antigenHigh IgG/IgA titersNot reported

Data synthesized from murine studies .

Comparative Analysis of SPase II Across Species

SpeciesLspA Identity vs E. coliKey DomainsFunctional Complementation in E. coli
Rickettsia typhi22%Conserved catalytic sitesPartial restoration
Streptococcus uberis40% (vs B. subtilis)Four transmembrane helicesRequires Eep for backup processing
Salmonella choleraesuis (inferred)~20–25% (predicted)Similar transmembrane topologyNot directly tested

Data derived from homologous systems .

Challenges and Future Directions

  • Low Complementation Efficiency: Heterologous LspA enzymes (e.g., R. typhi) show reduced activity in E. coli, likely due to divergent interaction partners in lipoprotein pathways .

  • Vaccine Optimization: Enhancing antigen secretion via engineered SPase II activity could improve recombinant Salmonella vaccine efficacy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
lspA; SCH_0041; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: sec:SCH_0041

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (LspA) and what role does it play in bacterial physiology?

Lipoprotein signal peptidase (LspA), also known as Type II Signal Peptidase (SPase II), is an essential enzyme responsible for cleaving the signal peptide sequence of lipoproteins in both gram-positive and gram-negative bacteria. It represents a critical component of the lipoprotein processing pathway that ensures proper localization and function of bacterial lipoproteins. LspA works downstream of prolipoprotein diacylglyceryl transferase (encoded by the lgt gene), which adds diacylglycerol to the cysteine residue in the lipobox motif of the signal peptide . After LspA cleaves the signal peptide, the mature lipoprotein is properly anchored to the bacterial membrane.

The importance of LspA has been demonstrated across multiple bacterial species including Rickettsia typhi, Streptococcus uberis, and Escherichia coli . In these organisms, LspA activity is essential for proper lipoprotein maturation, with implications for various cellular processes including nutrient acquisition, cell wall integrity, and virulence. For example, in Streptococcus uberis, a major cause of bovine mastitis, LspA plays a role in processing the manganese transporter lipoprotein MtuA, which is essential for growth in milk and for infection in lactating dairy cattle .

How is the lspA gene structurally organized and what are its conserved domains?

The lspA gene encodes a relatively small protein that contains several highly conserved domains essential for its signal peptidase activity. Comparative analysis of LspA proteins across different bacterial species reveals specific conserved amino acid residues and motifs that are crucial for enzymatic function. These include catalytic residues and membrane-spanning domains that position the enzyme properly within the bacterial membrane.

For example, in Rickettsia typhi, sequence analysis of the LspA protein shows the presence of highly conserved residues and domains that are essential for SPase II activity in lipoprotein processing . These conserved elements include transmembrane domains and catalytic residues that are critical for the enzyme's functionality. The conservation of these domains across evolutionarily distant bacterial species underscores their functional importance in lipoprotein processing.

What techniques can be used to demonstrate the functionality of recombinant LspA proteins?

Several experimental approaches can effectively demonstrate the functionality of recombinant LspA proteins:

Genetic Complementation Studies: A powerful approach involves complementing LspA-deficient strains with the recombinant LspA of interest. For example, researchers have used E. coli strain Y815, which contains a temperature-sensitive mutation in its native lspA gene. This strain cannot grow at 42°C due to accumulation of unprocessed prolipoproteins. Introduction of a functional lspA gene from another species can restore growth at this non-permissive temperature . In one study, R. typhi lspA was shown to restore growth of E. coli Y815 at 42°C by 4.7 ± 1.3% compared to growth at 30°C, demonstrating its functional activity .

Globomycin Resistance Assays: Globomycin is a specific inhibitor of LspA. Overexpression of functional LspA confers increased resistance to globomycin. In experiments with R. typhi LspA, E. coli cells expressing the recombinant protein showed significantly higher growth rates in the presence of globomycin (25-200 μg/ml) compared to control cells . This resistance profile provides strong evidence for functional activity of the recombinant LspA.

Western Blot Analysis: Detection of properly processed lipoproteins versus unprocessed precursors can be performed using Western blotting with antibodies specific to the lipoprotein of interest. This technique can directly demonstrate the processing activity of recombinant LspA .

How can recombinant Salmonella strains expressing heterologous LspA be constructed?

Construction of recombinant Salmonella strains expressing heterologous LspA involves several key steps:

  • Vector Selection: Choose an appropriate expression vector compatible with Salmonella. Plasmids with balanced copy numbers are important, as high-copy-number plasmids expressing recombinant proteins can be somewhat toxic and relatively unstable in Salmonella . For example, researchers found that high-copy-number plasmid pYA3193 (pUC ori) was relatively unstable for expressing certain recombinant proteins, with approximately 50% of cells losing the plasmid after 24 hours of growth .

  • Signal Sequence Engineering: For optimal expression and proper localization, the heterologous lspA gene can be fused with appropriate signal sequences. For instance, researchers have constructed vectors encoding the β-lactamase signal sequence fused in frame to recombinant proteins to direct translocation into the periplasmic space of Salmonella vaccine strains .

  • Promoter Selection: Choose appropriate promoters that provide stable expression in Salmonella. The trc (trp-lac) promoter has been successfully used in recombinant protein expression systems .

  • Confirmation of Expression: Verify expression using Western blot analysis with appropriate antibodies. For example, Anti-HisG monoclonal antibody detection has been used successfully for His-tagged recombinant proteins expressed in bacteria .

  • Stability Testing: Assess plasmid stability under various growth conditions to ensure consistent expression during the intended application period.

What methods can be used to measure immune responses to antigens delivered by recombinant Salmonella choleraesuis?

Multiple complementary approaches can be employed to comprehensively evaluate immune responses to antigens delivered by recombinant Salmonella:

Antibody Titer Determination: ELISA can be used to measure antibody responses in serum and mucosal secretions. This allows quantification of IgG, IgM, and IgA responses to the heterologous antigen. For example, studies have shown that oral immunization with recombinant Salmonella can induce significant antibody responses to expressed antigens, with approximately half of the antibodies being IgG1 (indicating a Th2-type response) .

Antibody Isotype Analysis: Determining the distribution of antibody isotypes (IgG1, IgG2a, etc.) provides insights into the type of immune response generated (Th1 vs. Th2). Research has shown that recombinant Salmonella vaccines can induce mixed responses with variations in IgG isotype ratios. For instance, antibodies to recombinant pneumococcal PspA antigen were predominantly IgG1 (indicating a Th2-type response), while antibodies to Salmonella components like LPS and outer membrane proteins were predominantly IgG2a (indicating a Th1-type response) .

Cytokine Profiling: Measuring cytokine production by stimulated immune cells can indicate the type and strength of the cellular immune response. Recent studies with recombinant Salmonella Choleraesuis expressing heterologous antigens showed induction of mixed Th1/Th2 cellular immune responses, which was advantageous for protection .

Challenge Studies: The most definitive measure of vaccine efficacy is protection against challenge with the virulent pathogen. For example, oral immunization with a Salmonella-PspA vaccine protected 60% of immunized mice from death after intraperitoneal challenge with 50 times the 50% lethal dose of virulent S. pneumoniae WU2 . Similarly, mice immunized with rSC0016(pS-PlpE) showed an 80% survival rate after challenge with P. multocida, compared to 60% in the inactivated vaccine group .

How does LspA processing contribute to bacterial pathogenesis and virulence?

LspA processing of bacterial lipoproteins significantly impacts pathogenesis and virulence through several mechanisms:

Essential Virulence Factors: Many bacterial lipoproteins processed by LspA function as virulence factors. For example, in Streptococcus uberis, the manganese transporter MtuA (processed by LspA) is essential for growth in milk and for causing mastitis in dairy cattle . Properly processed MtuA localizes to the cell membrane and enables the bacterium to acquire essential nutrients in the host environment.

Immune Recognition and Evasion: Lipoproteins are recognized by host pattern recognition receptors like Toll-like receptor 2 (TLR2). Proper processing by LspA can affect how these molecules interact with the host immune system, potentially contributing to immune evasion strategies.

Membrane Integrity and Stress Responses: Defects in lipoprotein processing due to LspA inactivation can compromise membrane integrity and alter bacterial responses to environmental stresses encountered during infection.

Alternative Processing Pathways: Interestingly, in some bacteria like Streptococcus uberis, disruption of lspA reveals alternative lipoprotein processing mechanisms. An S. uberis lsp mutant displayed novel lipoprotein processing, where a lower-molecular-weight derivative of MtuA was evident during late log phase . Further investigation identified that eep (a homologue of the Enterococcus faecalis "enhanced expression of pheromone" gene) plays a role in alternative cleavage of lipoproteins in the absence of Lsp . This suggests bacteria may have backup systems for lipoprotein processing that could contribute to pathogenesis when the primary pathway is disrupted.

What are the advantages of using recombinant Salmonella expressing heterologous antigens as vaccine vectors?

Recombinant Salmonella vaccine vectors offer several significant advantages over traditional vaccine approaches:

Induction of Comprehensive Immune Responses: Live attenuated Salmonella strains can stimulate multiple arms of the immune system, including mucosal, humoral, and cellular responses. This mimics natural infections and can provide more robust protection . For example, recombinant Salmonella Choleraesuis expressing Pasteurella lipoprotein E (PlpE) induced higher antigen-specific mucosal, humoral, and mixed Th1/Th2 cellular immune responses compared to inactivated vaccines .

Mucosal Delivery: Oral administration of recombinant Salmonella vaccines allows for direct stimulation of the gut-associated lymphoid tissue (GALT), which is advantageous for protection against many pathogens that enter through mucosal surfaces.

Adjuvant Effect: Salmonella components act as natural adjuvants that enhance the immune response to the heterologous antigen. This can reduce or eliminate the need for additional adjuvants.

Ease of Administration: Oral delivery is non-invasive and eliminates the need for injections, potentially increasing compliance and reducing delivery costs.

Temperature Stability: Live attenuated Salmonella strains can be more stable than purified protein antigens, potentially reducing cold-chain requirements.

Versatility: The Salmonella vector can be engineered to express multiple antigens simultaneously, potentially providing protection against several pathogens with a single vaccine.

What strategies can improve expression and delivery of heterologous antigens in recombinant Salmonella choleraesuis?

Several strategies have been developed to enhance the efficacy of recombinant Salmonella as vaccine vectors:

Optimized Antigen Expression Systems: Developing stable expression systems is crucial. Researchers have constructed improved plasmid vectors to enable stable expression of recombinant proteins in attenuated Salmonella . For example, multicopy Asd+ antigen expression vectors encoding appropriate signal sequences can direct recombinant proteins to the periplasmic space or for secretion, enhancing immune recognition .

Balanced Attenuation: The degree of attenuation must balance safety with sufficient persistence to stimulate robust immune responses. Various genetic modifications can achieve this balance, including deletions in genes like guaBA, clpP, and fliD .

Targeting Antigen to Specific Cellular Compartments: Directing antigens to specific cellular locations can affect processing and presentation pathways. For example, engineering the β-lactamase signal sequence fused to antigens can translocate them into the periplasmic space, with some portion reaching the supernatant fluid without cell lysis .

Multiple Antigen Delivery: Co-expression of immunomodulatory molecules or multiple protective antigens can enhance vaccine efficacy. This approach can provide broader protection or specifically shape the type of immune response generated.

What factors might explain variability in immune responses to recombinant Salmonella vaccines?

Several factors can contribute to variability in immune responses to recombinant Salmonella vaccines:

Plasmid Stability Issues: Expression plasmids can be unstable in vivo, resulting in loss of antigen expression. Research has shown that high-copy-number plasmids expressing recombinant proteins can be toxic to Salmonella, with approximately 50% of cells losing the plasmid after 24 hours of growth . This instability can significantly impact antigen delivery and subsequent immune responses.

Antigen Expression Levels: The level of heterologous antigen expression can greatly influence immune responses. Too little expression may not stimulate adequate responses, while too much can be toxic to the Salmonella vector and reduce its ability to colonize host tissues.

Vector Persistence: The duration of Salmonella persistence in host tissues affects the magnitude and quality of the immune response. Different attenuation strategies result in varying levels of persistence.

Pre-existing Anti-Salmonella Immunity: Prior exposure to Salmonella (natural infection or previous vaccination) can reduce vector efficacy through rapid clearance before adequate antigen delivery occurs.

Host Genetic Factors: Host genetics influence immune responses to both the Salmonella vector and the heterologous antigen. Different mouse strains, for example, can show markedly different responses to the same vaccine construct.

Route of Administration: While oral delivery is common, different administration routes (intranasal, intraperitoneal, etc.) can result in different immune response profiles.

How can researchers distinguish between immune responses to the Salmonella vector versus the heterologous antigen?

Differentiating immune responses to the Salmonella vector from those to the heterologous antigen is crucial for vaccine evaluation:

Control Groups: Include appropriate controls such as empty vector Salmonella strains (without the heterologous antigen) to establish baseline responses to vector components alone. For example, in studies with recombinant Salmonella Choleraesuis, comparison groups included empty vector (rSC0016(pYA3493)) to establish baseline responses to Salmonella antigens alone .

Antigen-Specific Assays: Use purified heterologous antigen (produced separately from the Salmonella vector) in immunological assays to specifically measure responses to that component.

Comparative Isotype Analysis: The distribution of antibody isotypes can differ between responses to the vector and the heterologous antigen. Research shows that antibodies to recombinant pneumococcal PspA antigen were predominantly IgG1 (indicating a Th2-type response), while antibodies to Salmonella components like LPS and outer membrane proteins were predominantly IgG2a (indicating a Th1-type response) . This isotype pattern can help distinguish the two types of responses.

T Cell Epitope Mapping: Use of peptide libraries derived from the heterologous antigen can identify specific T cell responses directed against that component rather than Salmonella antigens.

Challenge Studies: Challenge with the pathogen targeted by the heterologous antigen (rather than with Salmonella) directly tests protection conferred by responses to that antigen. For example, mice immunized with Salmonella-PspA vaccine showed 60% protection against challenge with virulent S. pneumoniae WU2 , indicating effective immune responses to the heterologous PspA antigen.

What molecular techniques can be used to confirm proper processing of lipoproteins by recombinant LspA?

Several molecular approaches can verify proper lipoprotein processing by recombinant LspA:

Western Blot Analysis: This technique can directly visualize shifts in molecular weight between unprocessed and processed forms of lipoproteins. For example, in S. uberis lsp mutants, full-length (uncleaved) MtuA was detected by Western blotting, contrasting with the properly processed form in wild-type bacteria . In complementation experiments, restoration of proper processing can be visualized using this approach.

Mass Spectrometry: This provides precise molecular weight determination and can identify the exact cleavage site used by LspA. It can also detect lipid modifications that occur during lipoprotein maturation.

N-terminal Sequencing: Direct sequencing of the N-terminus of mature lipoproteins can confirm proper signal peptide cleavage by LspA.

Globomycin Inhibition Studies: Globomycin specifically inhibits LspA. Treatment of bacteria expressing recombinant LspA with globomycin should lead to accumulation of unprocessed prolipoproteins, which can be detected by Western blotting. Conversely, overexpression of functional LspA confers increased resistance to globomycin, as demonstrated in studies where E. coli expressing R. typhi LspA showed significantly higher growth in the presence of globomycin (25-200 μg/ml) compared to control cells .

Subcellular Localization Studies: Properly processed lipoproteins should localize correctly to the appropriate membrane. Techniques like membrane fractionation followed by Western blotting or immunofluorescence microscopy can verify correct localization, indirectly confirming proper processing by LspA.

What novel applications of recombinant Salmonella-LspA technology are being explored?

Current research is exploring several innovative applications for recombinant Salmonella and LspA technology:

Multi-antigen Delivery Systems: Developing Salmonella vectors that simultaneously express multiple protective antigens from different pathogens could lead to multivalent vaccines. This approach could significantly reduce the number of immunizations required for comprehensive protection.

Therapeutic Protein Delivery: Beyond vaccines, recombinant Salmonella could be engineered to deliver therapeutic proteins to specific tissues, potentially opening new avenues for treating various diseases.

LspA as an Antimicrobial Target: Given the importance of LspA for bacterial viability and virulence in many species, it represents a potentially valuable target for new antimicrobial development. Understanding its structure and mechanism through recombinant expression studies could facilitate drug design efforts.

Biomarker Development: Research into LspA-processed lipoproteins could identify novel biomarkers for bacterial infections, potentially improving diagnostic capabilities.

Engineered Probiotics: Recombinant attenuated Salmonella strains with modified LspA processing pathways could be developed as engineered probiotics with enhanced beneficial properties or reduced inflammatory potential.

How might gene expression regulation of lspA affect recombinant Salmonella vaccine efficacy?

The regulation of lspA expression can significantly impact vaccine vector performance:

Expression Timing: Research shows that lspA and related protein processing genes show differential expression patterns during various stages of bacterial growth. For example, in Rickettsia typhi, transcription of lspA, lgt, and lepB (encoding type I signal peptidase) shows a differential expression pattern during various stages of intracellular growth . Similar regulatory patterns in Salmonella could affect the processing of heterologous antigens expressed at different growth phases.

Stress Response Effects: Environmental stresses encountered during infection can alter lspA expression. Understanding and potentially modifying these responses could enhance vaccine performance under varying conditions.

Coordinated Expression: The relative expression levels of lspA compared to other lipoprotein processing enzymes (like Lgt) may need to be balanced for optimal function. Studies in Rickettsia typhi showed that lspA and lgt, which are involved in lipoprotein processing, show similar levels of expression, while lepB, involved in non-lipoprotein secretion, shows higher expression levels . This suggests a coordinated regulation that might be important for vaccine vector performance.

Host-induced Regulation: Host factors encountered during infection may affect lspA expression. Designing recombinant Salmonella with modified lspA regulation could potentially enhance antigen delivery in specific host tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.