Recombinant Salmonella choleraesuis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Production in E. coli:
Recombinant nuoA is expressed with an N-terminal His-tag for purification via affinity chromatography .

Applications:

  • Structural Studies: Investigating membrane topology and subunit interactions .

  • Enzyme Kinetics: Analyzing electron transfer rates and quinone binding .

  • Therapeutic Research: Exploring resistance mechanisms to Complex I inhibitors .

Research Findings and Functional Insights

Electron Transfer Dynamics:

  • Redox Steps:

    1. NADH reduces FAD in NuoF → 2Fe-2S cluster → FMN in NuoB/C → riboflavin → quinone .

    2. Proton translocation occurs during FMN reduction .

  • Suppressor Mutations: Missense mutations in nuoG, nuoM, and nuoN rescue respiratory defects in ubiquinone-deficient Salmonella, highlighting subunit interdependence .

Quinone Binding and Inhibition:

  • Ubiquinone-8 binds to NqrA in Na⁺-NQR (Vibrio cholerae), but Salmonella nuoA lacks direct quinone-binding residues .

  • Inhibitors: DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) inhibits quinone reduction, affecting electron flow .

Comparative Analysis of Salmonella nuoA Variants

StrainUniProt IDAA Sequence (Partial)TagSource
S. choleraesuisQ57M37MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVHis
S. dublinB5FPG9MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTAHis
S. gallinarumN/APartial sequence (1-147 aa)N/A
S. heidelbergB4TBJ4MSMSTSTEVIAHHWAFAIFLIVAIGLCCLmLVGGWFLGGRARARHKNVPFESGIDSVGTAN/A

Note: Salmonella choleraesuis nuoA lacks direct quinone-binding motifs but stabilizes interactions via structural roles .

Challenges and Future Directions

  • Stability: Recombinant nuoA requires glycerol (50%) for long-term storage to prevent aggregation .

  • Mechanistic Gaps: Detailed electron transfer pathways in Salmonella Complex I remain unresolved; cryo-EM studies are needed .

  • Therapeutic Potential: Suppressor mutations in nuoG, nuoM, and nuoN suggest targets for antimicrobial strategies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoA; SCH_2328; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase subunit A) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus harnessing the redox energy in a proton gradient.

Database Links

KEGG: sec:SCH_2328

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit A (nuoA) in Salmonella choleraesuis metabolism?

NADH-quinone oxidoreductase (NQR) functions as a critical enzyme in the respiratory chain of many bacteria, including Salmonella choleraesuis. The subunit A (nuoA) specifically contributes to the enzyme complex that catalyzes electron transfer from NADH to quinones in the respiratory chain. This process is fundamental to energy metabolism in these bacteria, facilitating ATP production through the generation of proton motive force. In Salmonella species, unlike the Na+-NQR found in Vibrio cholerae, the enzyme primarily contributes to proton translocation rather than sodium ion translocation. The enzyme plays a crucial role in the bacterium's ability to adapt to different environmental conditions and energy requirements, particularly during infection processes and survival within host environments .

How does the function of nuoA in S. choleraesuis compare to homologous subunits in other bacteria?

The nuoA subunit in S. choleraesuis shares functional similarities with homologous subunits in other bacteria, but with notable differences in regulatory mechanisms and specific contributions to pathogenicity. Unlike the Na+-translocating NADH:quinone oxidoreductase found in Vibrio cholerae, which is influenced by environmental sodium ions and contributes to pathogenicity through active sodium extrusion, the nuoA in S. choleraesuis is part of a proton-translocating complex. In V. cholerae, the Na+-NQR has been shown to generate ubisemiquinones whose concentration increases with sodium concentration (from 0.2 mM at 0.08 mM Na+ to 0.4 mM at 14.7 mM Na+), consequently influencing the redox state of the quinone pool and production of reactive oxygen species . While S. choleraesuis utilizes similar electron transfer principles, its NQR complex likely evolved different mechanisms for energy coupling and contribution to virulence, reflected in its adaptation to specific host environments and pathogenicity mechanisms.

What genetic elements are essential for successful expression of recombinant nuoA in experimental systems?

Successful expression of recombinant nuoA in S. choleraesuis requires careful consideration of several genetic elements:

  • Promoter selection: Based on approaches used with other recombinant proteins in S. choleraesuis, regulated promoters like the araBAD promoter system (PBAD) have demonstrated effectiveness. This system allows for controlled expression through arabinose induction, as demonstrated in recombinant S. Choleraesuis strains like rSC0012 (ΔPfur88::TT araC PBAD fur Δpmi-2426 ΔrelA199::araC PBAD lacI TT ΔasdA33) .

  • Plasmid stability elements: For stable maintenance of nuoA expression constructs, balanced-lethal host-vector systems utilizing the asd gene have shown 100% stability through 50 generations in S. Choleraesuis, as demonstrated with other recombinant proteins .

  • Terminator sequences: Proper transcription termination sequences (TT) are crucial for expression control and preventing readthrough transcription, as implemented in existing recombinant S. Choleraesuis strains .

  • Codon optimization: Adaptation of the nuoA coding sequence to the preferred codon usage of S. choleraesuis is essential to ensure efficient translation and high-level protein expression.

The design should incorporate these elements while considering the specific experimental objectives and the physiological impact of nuoA overexpression on bacterial metabolism.

What are the optimal conditions for expressing recombinant nuoA in Salmonella choleraesuis?

The optimal conditions for expressing recombinant nuoA in Salmonella choleraesuis require careful optimization of multiple parameters:

Expression System Parameters:

  • Vector selection: Asd+ plasmids have demonstrated 100% stability in recombinant S. Choleraesuis through 50 generations, making them excellent candidates for nuoA expression .

  • Induction conditions: For arabinose-inducible systems like PBAD, optimal arabinose concentration typically ranges from 0.1-0.2% (w/v) with induction at mid-logarithmic phase (OD600 0.4-0.6).

  • Growth temperature: 30-32°C during induction phase to balance protein folding efficiency and expression levels.

Media and Growth Conditions:

  • Base medium: Nutrient-rich media supplemented with appropriate selective markers.

  • Oxygen availability: Since nuoA functions in respiratory chains, microaerobic conditions (2-10% O2) may better mimic physiological conditions.

  • Growth phase: Initial culture in logarithmic phase before induction ensures optimal cellular energy status.

Purification Considerations:

  • Cell lysis: Gentle lysis methods to preserve membrane integrity where nuoA would naturally reside.

  • Detergent selection: Non-ionic detergents (0.5-1% DDM or Triton X-100) for membrane protein solubilization.

  • Buffer composition: Including 10-20% glycerol and 100-250 mM NaCl to maintain protein stability.

These parameters should be systematically optimized for specific experimental objectives and protein requirements, particularly considering nuoA's role in electron transport chains and its membrane association.

What methods are most effective for assessing nuoA functionality in recombinant S. choleraesuis strains?

Assessing nuoA functionality in recombinant S. choleraesuis requires a multi-faceted approach that examines enzyme activity, electron transfer efficiency, and physiological impacts:

Enzymatic Activity Assays:

Electron Transfer Assessment:

  • Electron paramagnetic resonance (EPR) spectroscopy: This technique can detect organic radicals formed during electron transfer, particularly ubisemiquinones. In V. cholerae, NADH-induced radical signals were approximately twice as strong in wild-type strains compared to NQR-deficient mutants .

  • Reactive oxygen species (ROS) quantification: Measurement of superoxide and hydrogen peroxide production using assays such as cytochrome c reduction or Amplex Red. Wild-type V. cholerae produced extracellular superoxide at 10.2 nmol min−1 mg−1 compared to 3.1 nmol min−1 mg−1 in NQR deletion strains .

Physiological Impact Evaluation:

  • Growth curve analysis: Comparison of growth rates under various carbon sources and oxygen conditions.

  • Membrane potential measurement: Using fluorescent probes to assess the contribution to proton motive force.

Assay TypeParameter MeasuredWild-type Reference Value*Expected Effect of nuoA Mutation
NADH OxidationActivity rate0.4-0.5 μmol min−1mg−1Significant reduction
Ag+ Inhibition% Activity remaining14% at 1 μM Ag+Minimal effect
Superoxide ProductionFormation rate10.2 nmol min−1 mg−1Reduction to ~30%
H2O2 FormationFormation rate30.9 nmol min−1 mg−1Reduction to ~30%
EPR SignalRadical intensity2x compared to mutantSignificant reduction

*Reference values from V. cholerae studies , actual values for S. choleraesuis may vary but follow similar patterns.

How can researchers effectively detect and quantify nuoA expression levels in recombinant systems?

Effective detection and quantification of nuoA expression in recombinant Salmonella choleraesuis systems requires a combination of protein analysis techniques, each with specific advantages for membrane proteins like nuoA:

Immunological Methods:

  • Western blotting: Using anti-nuoA antibodies or antibodies against epitope tags (His, FLAG) if incorporated into the recombinant construct. This provides specific detection and semi-quantitative analysis of expression levels.

  • ELISA: For more precise quantification when suitable antibodies are available.

Mass Spectrometry-Based Approaches:

  • Targeted proteomics: Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) can provide absolute quantification of nuoA with appropriate standards.

  • Global proteomics: Label-free quantification or isotope labeling approaches (SILAC, TMT) for relative abundance measurement across different conditions.

Activity-Based Quantification:

  • Functional correlation: Measuring NADH oxidation activity and correlating with protein expression. In V. cholerae studies, Na+-NQR content was estimated by dividing total Na+-NQR activity (0.43 μmol NADH min−1 mg−1) by the turnover number determined for purified Na+-NQR (16,000 μmol NADH μmol−1 Na+-NQR min−1), yielding approximately 0.03 nmol mg−1 protein .

Real-time Expression Monitoring:

  • Reporter gene fusions: Creating translational fusions of nuoA with fluorescent proteins or luciferase for real-time monitoring, being mindful that C-terminal fusions may disrupt membrane insertion.

  • Transcriptional analysis: RT-qPCR to measure nuoA mRNA levels as a proxy for expression.

Sample Preparation Considerations:

  • Membrane fractionation is critical for accurate assessment of membrane-associated nuoA

  • Detergent selection impacts extraction efficiency; a panel approach using multiple detergents (DDM, Triton X-100, CHAPS) at varying concentrations may be necessary to optimize recovery

A combinatorial approach using multiple methods provides the most comprehensive assessment of nuoA expression, especially when distinguishing between expression level and functional activity.

How does nuoA contribute to electron transfer and energy metabolism in S. choleraesuis during different growth conditions?

The NADH-quinone oxidoreductase subunit A (nuoA) plays a dynamic role in S. choleraesuis energy metabolism, with contributions that vary significantly across growth conditions:

Aerobic vs. Anaerobic Metabolism:
Under aerobic conditions, nuoA participates in a proton-translocating complex that couples NADH oxidation to quinone reduction, thereby contributing to the proton motive force. In contrast to Na+-NQR in V. cholerae, which forms ubisemiquinones that increase with Na+ concentration (0.2 mM at 0.08 mM Na+ to 0.4 mM at 14.7 mM Na+) , the S. choleraesuis enzyme likely shows different ion coupling. Under anaerobic conditions, the contribution of nuoA to energy metabolism decreases as alternative electron acceptors become more important.

Carbon Source Utilization:
The contribution of nuoA to electron transfer varies with carbon source. With glycolytic substrates producing high NADH/NAD+ ratios, nuoA-containing complex becomes critical for redox balance maintenance. With gluconeogenic substrates, its contribution likely diminishes as NADH production decreases.

Intracellular vs. Extracellular Environment:
During host cell invasion, S. choleraesuis encounters varying pH, nutrient availability, and oxygen tension. The nuoA-containing complex likely undergoes regulatory adjustments to optimize energy production under these challenging conditions. Similar to how Na+-NQR in V. cholerae influences pathogenicity, the proton-translocating complex in S. choleraesuis may contribute to virulence by maintaining membrane potential during host infection.

Stress Response Integration:
Under oxidative stress, the electron transfer through nuoA must balance energy production against excessive ROS formation. Unlike V. cholerae, where Na+-NQR significantly contributes to ROS production (wild-type producing 10.2 nmol min−1 mg−1 superoxide compared to 3.1 nmol min−1 mg−1 in the NQR deletion strain) , the proton-translocating complex in S. choleraesuis may have evolved different mechanisms to regulate electron leakage to oxygen.

Research Challenges:
Investigating these dynamic roles requires sophisticated approaches including:

  • Real-time measurement of membrane potential in live cells under various conditions

  • Isotope labeling to track electron flow through different respiratory pathways

  • In vivo measurement of NADH/NAD+ ratios during infection models

What are the most significant challenges in creating stable recombinant S. choleraesuis strains expressing modified nuoA variants?

Creating stable recombinant S. choleraesuis strains expressing modified nuoA variants presents several significant challenges that must be addressed through careful experimental design:

Membrane Protein Expression Challenges:

  • Protein folding and insertion: As a membrane protein, nuoA requires proper folding and insertion into the bacterial membrane. Modified variants may disrupt these processes, leading to inclusion body formation or protein degradation.

  • Subunit assembly dynamics: NuoA functions within a multi-subunit complex; modifications can disrupt critical protein-protein interactions required for complex assembly and stability.

Metabolic Burden and Toxicity:

  • Energy metabolism disruption: Overexpression or modification of nuoA may alter electron flow through the respiratory chain, potentially disrupting the proton motive force and cellular energy balance.

  • ROS production: Similar to findings in V. cholerae, where Na+-NQR contributes significantly to superoxide and H2O2 formation , modified nuoA variants might increase harmful ROS production.

Genetic Stability Challenges:

  • Selection pressure: Maintaining stable expression requires appropriate selection strategies. Balanced-lethal host-vector systems using the asd gene have shown 100% stability in S. Choleraesuis for other recombinant proteins over 50 generations , suggesting this approach for nuoA variants.

  • Codon optimization: Suboptimal codon usage can lead to ribosomal pausing and reduced expression, requiring careful sequence design.

Technical Solutions:

  • Regulated expression systems: Implementing tightly controlled inducible promoters like PBAD used in S. Choleraesuis strains rSC0012 can help manage potentially toxic expression.

  • Fusion strategies: N-terminal fusions with soluble protein partners or the incorporation of affinity tags can improve folding and stability.

  • Host strain engineering: Modifying chaperone expression or membrane composition in host strains may improve nuoA variant incorporation and stability.

Experimental Validation Approaches:

  • Long-term stability testing: Assessing genetic and functional stability through continuous culture for at least 50 generations, as performed with other recombinant proteins in S. Choleraesuis .

  • Stress response monitoring: Measuring growth impacts under various stressors to evaluate potential fitness costs of nuoA variants.

How can researchers resolve contradictions in functional data when studying nuoA in different experimental systems?

Resolving contradictions in functional data when studying nuoA across different experimental systems requires systematic investigation of multiple factors that can influence experimental outcomes:

Source of Contradictions and Resolution Strategies:

  • Strain Background Variations:

    • Analysis approach: Compare complete genome sequences of strains used, focusing on other respiratory chain components and global regulators.

    • Resolution strategy: Create isogenic strains where only nuoA differs, maintaining identical genetic backgrounds for direct comparison.

    • Validation technique: Complementation studies where the native nuoA gene is replaced with variants in the same genetic background.

  • Expression Level Disparities:

    • Analysis approach: Quantify absolute expression levels of nuoA across systems using targeted proteomics. Variation in NADH dehydrogenase activity (0.4-0.5 μmol min−1mg−1) has been observed even between wild-type and mutant strains of related bacteria .

    • Resolution strategy: Implement dose-response experiments with titratable promoter systems to determine how expression level affects function.

    • Standardization method: Develop a standard curve relating protein quantity to functional output to normalize across systems.

  • Environmental Condition Differences:

    • Analysis approach: Comprehensively document all growth and assay conditions, particularly oxygen availability, pH, and ion concentrations that can affect electron transport chain function.

    • Resolution strategy: Create a standardized testing matrix spanning relevant physiological conditions. In V. cholerae, Na+ concentration significantly impacts NQR function, with radical concentration increasing from 0.2 mM at 0.08 mM Na+ to 0.4 mM at 14.7 mM Na+ .

    • Validation approach: Identify condition-specific effects through factorial experimental design.

  • Assay Methodology Inconsistencies:

    • Analysis approach: Compare detailed protocols for functional assays, identifying differences in sample preparation, buffer composition, and detection methods.

    • Resolution strategy: Perform side-by-side comparisons of different methodologies on identical samples.

    • Standardization approach: Develop and distribute standard operating procedures and reference materials to normalize across laboratories.

Data Integration Framework:

Data Contradiction TypeCharacterization MethodIntegration ApproachValidation Strategy
Quantitative differences in activitySide-by-side assays with standardized protocolsNormalization to internal standardsInterlaboratory testing with reference samples
Qualitative differences in phenotypesComprehensive phenotyping under standardized conditionsIdentification of condition-specific effectsGenetic complementation testing
Structural-functional relationshipsDetailed structural analysis of variantsStructure-guided mutagenesisCorrelation of structural changes with functional outcomes
Systems-level impactMulti-omics profiling across experimental systemsNetwork analysis of differential responsesIdentification of system-specific compensatory mechanisms

By implementing this systematic approach, researchers can disentangle genuine biological effects from technical artifacts, advancing our understanding of nuoA function across different contexts.

How does nuoA contribute to the pathogenicity and virulence of S. choleraesuis?

The NADH-quinone oxidoreductase subunit A (nuoA) contributes to S. choleraesuis pathogenicity through multiple interconnected mechanisms related to energy metabolism and adaptation within host environments:

Energy Production During Infection:
NuoA's role in the respiratory chain is crucial for maintaining adequate ATP levels during the metabolic stress of host invasion and colonization. Unlike the Na+-NQR system in V. cholerae that contributes to pathogenicity through sodium ion extrusion , the proton-translocating complex in S. choleraesuis likely enables adaptation to the varying energy requirements encountered during infection.

Redox Balance and Oxidative Stress Response:
The nuoA-containing complex participates in maintaining redox homeostasis within the bacterium during exposure to host-generated reactive oxygen species. In V. cholerae, the Na+-NQR significantly contributes to superoxide production (10.2 nmol min−1 mg−1 in wild-type vs. 3.1 nmol min−1 mg−1 in deletion strains) , suggesting similar systems in S. choleraesuis may influence redox status during infection.

Intracellular Survival Mechanisms:
S. choleraesuis can survive within macrophages, an environment with limited nutrients and altered oxygen availability. The adaptable electron transport chain involving nuoA likely facilitates this survival by:

  • Enabling energy production under microaerobic conditions

  • Contributing to membrane potential maintenance critical for various virulence-associated transport systems

  • Supporting pH homeostasis in the acidic phagosomal environment

Host-Pathogen Signaling Interface:
Emerging evidence suggests respiratory chain components may influence virulence gene expression through:

  • Sensing host-specific environmental cues

  • Modulating bacterial second messenger levels based on metabolic status

  • Influencing quorum sensing mechanisms through effects on membrane potential

Experimental Evidence from Related Systems:
While direct evidence for nuoA specifically is limited, studies on related respiratory enzymes in Salmonella strains demonstrate their importance in virulence. The recombinant attenuated S. Choleraesuis strains described in the literature (rSC0011 and rSC0012) show altered immunogenicity and protection against challenges , suggesting respiratory function impacts pathogenicity and host immune responses.

What are the potential applications of recombinant S. choleraesuis expressing modified nuoA in vaccine development?

Recombinant S. choleraesuis strains expressing modified nuoA present several promising applications for vaccine development, building on principles demonstrated with other attenuated Salmonella vaccine vectors:

Attenuation Strategy Optimization:
Modified nuoA can serve as a novel attenuation target by precisely calibrating bacterial metabolism. This approach offers advantages over traditional attenuation methods:

  • Fine-tuned attenuation through specific nuoA modifications rather than complete gene deletion

  • Metabolic attenuation that maintains immunogenicity while reducing reactogenicity

  • Potential for environment-responsive attenuation that is active primarily in vivo

Studies with attenuated S. Choleraesuis vectors like rSC0012 have demonstrated that regulated mutations in metabolic genes can reduce reactogenicity while maintaining immunogenicity . A similar approach with nuoA could yield vaccine candidates with optimized safety profiles.

Antigen Delivery Platform Enhancement:
Engineered nuoA variants could improve antigen delivery in several ways:

  • Increased persistence: Subtle modifications in respiratory function can extend the duration of antigen presentation without increasing reactogenicity

  • Tissue-specific activity: Engineering nuoA variants responsive to tissue-specific signals could target antigen delivery to relevant immune induction sites

  • Adjuvant effect modulation: NuoA's influence on ROS production could be leveraged to modulate innate immune activation

The successful delivery of heterologous antigens (like SaoA) in attenuated S. Choleraesuis strains with 100% plasmid stability through 50 generations provides a foundation for similar approaches with nuoA-modified strains.

Multivalent Vaccine Development:
Modified nuoA strains can serve as platforms for multivalent vaccines:

  • Co-expression systems: Using nuoA modification for attenuation while delivering multiple antigens from other pathogens

  • Synergistic immunity: Combining modified respiratory function with targeted antigen delivery to enhance both innate and adaptive responses

The protection demonstrated by recombinant S. Choleraesuis vaccine rSC0012(pS-SaoA) against both S. Choleraesuis and S. suis challenges in mice illustrates the potential for multivalent protection.

Experimental Considerations for Development:

  • Safety assessment: Comprehensive evaluation of attenuation stability through multiple passages

  • Immunogenicity profiling: Measurement of both humoral (serum IgG, mucosal IgA) and cellular immune responses

  • Challenge studies: Protection evaluation against multiple strains and routes of infection

Vaccine Design ParameterStandard ApproachnuoA-Based InnovationExpected Benefit
Attenuation MechanismGene deletion (e.g., Δcrp, Δasd)Engineered nuoA variantsFine-tuned metabolism for balanced safety/immunogenicity
Antigen ExpressionConstitutive promotersnuoA-linked environmental sensingContext-appropriate antigen expression
Immune ProfilePrimarily Th1-dominatedBalanced Th1/Th2 through ROS modulationMore complete protective immunity
Safety ProfileStatic attenuationDynamic, responsive attenuationReduced reactogenicity while maintaining immunogenicity

How can nuoA be utilized as a target for novel antimicrobial development against S. choleraesuis?

The NADH-quinone oxidoreductase subunit A (nuoA) represents a promising but underexplored target for novel antimicrobial development against Salmonella choleraesuis. Its essential role in energy metabolism provides multiple intervention opportunities:

Target Validation and Druggability:
NuoA's critical function in the respiratory chain makes it an attractive antimicrobial target for several reasons:

  • Essential function: Disruption of respiratory chain components typically has severe consequences for bacterial viability, especially under in vivo conditions.

  • Selective targeting potential: Structural differences between bacterial and mammalian respiratory complexes offer selectivity windows for antimicrobial design.

  • Limited resistance development: The essential nature of electron transport may constrain resistance-conferring mutations without significant fitness costs.

Inhibitor Design Strategies:
Several approaches show promise for developing nuoA-targeted antimicrobials:

  • Structure-based design: Utilizing structural data to design small molecules that:

    • Disrupt nuoA-quinone interactions

    • Interfere with subunit assembly of the respiratory complex

    • Block conformational changes required for electron transfer

  • Natural product derivatives: Screening and modifying compounds known to affect respiratory function:

    • Quinone analogs that compete for binding sites

    • Polyphenolic compounds that disrupt electron transfer

    • Membrane-active compounds that specifically destabilize respiratory complexes

  • Peptide inhibitors: Developing peptides that mimic interface regions between nuoA and other subunits to disrupt complex assembly.

Experimental Approaches for Inhibitor Discovery:

  • High-throughput screening: Using membrane preparations with nuoA-dependent NADH oxidation activity as a primary screen. Similar enzyme activity measurements in V. cholerae (0.4-0.5 μmol min−1mg−1) provide methodological foundations.

  • EPR-based screening: Measuring effects on radical species formation as detected in V. cholerae membranes , looking for compounds that specifically disrupt nuoA-dependent radical signals.

  • Whole-cell respiration assays: Measuring oxygen consumption in intact cells to identify compounds that specifically inhibit the respiratory chain.

Potential Advantages of nuoA-Targeted Antimicrobials:

  • Novel mode of action: Addressing antimicrobial resistance through mechanisms distinct from current antibiotics.

  • Potentiation of existing antibiotics: Respiratory chain inhibitors may enhance the efficacy of other antimicrobials by reducing bacterial energy availability for resistance mechanisms.

  • Anti-virulence effects: Subtotal inhibition may attenuate bacterial virulence without selecting strongly for resistance.

Challenges and Considerations:

  • Membrane permeability: Designing compounds that penetrate the Gram-negative outer membrane to reach nuoA.

  • Selectivity optimization: Ensuring specificity for bacterial respiratory complexes over mammalian counterparts.

  • Resistance monitoring: Tracking potential compensatory mutations in alternate respiratory pathways.

What emerging technologies show promise for advancing nuoA research in S. choleraesuis?

Several cutting-edge technologies are poised to transform nuoA research in Salmonella choleraesuis, enabling deeper insights into its structure, function, and biological significance:

Advanced Structural Characterization:

  • Cryo-electron microscopy (cryo-EM): Near-atomic resolution structures of intact respiratory complexes containing nuoA in native membrane environments, revealing dynamic conformational changes during electron transfer.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping protein dynamics and conformational changes in nuoA under different physiological conditions.

  • Single-particle electron microscopy: Visualizing assembly and organization of respiratory supercomplexes incorporating nuoA in bacterial membranes.

Real-time Functional Analysis:

  • Electrochemical scanning microscopy: Mapping electron transfer in live bacterial cells with nanoscale resolution.

  • Genetically encoded redox sensors: FRET-based sensors for tracking changes in redox state in real-time during infection processes.

  • Microfluidic respirometry: Single-cell analysis of respiratory function across bacterial populations to capture heterogeneity in nuoA activity.

Genetic Engineering Advancements:

  • CRISPR-Cas base editing: Precise single nucleotide modifications in nuoA without double-strand breaks, enabling subtle functional variations without complete gene disruption.

  • Inducible degrons: Temporal control of nuoA function through degron-fusion constructs, allowing precise timing of respiratory chain disruption.

  • Multiplex genome engineering: Simultaneously modifying nuoA and interacting components to map epistatic relationships within respiratory networks.

Systems Biology Approaches:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics to understand nuoA's role in global bacterial physiology. This builds on approaches used in other bacterial systems like V. cholerae, where NQR function has been linked to widespread metabolic effects .

  • Flux balance analysis: Computational modeling of metabolic flux distributions in wild-type versus nuoA-modified strains across infection-relevant conditions.

  • Single-cell RNA-seq: Capturing population heterogeneity in respiratory gene expression during host-pathogen interactions.

Advanced Infection Models:

  • Organoid infection systems: Studying nuoA function during infection of three-dimensional tissue models that better recapitulate host environments.

  • Intravital microscopy: Real-time imaging of nuoA-modified bacteria during in vivo infection processes.

  • Host-microbiome models: Investigating nuoA's role in competitiveness within complex microbial communities.

These emerging technologies will enable researchers to move beyond traditional biochemical approaches to understand nuoA's role in the complex, dynamic environments encountered by S. choleraesuis during infection and transmission.

What are the most critical unresolved questions regarding nuoA function in S. choleraesuis?

Despite advances in understanding bacterial respiratory chains, several critical questions about nuoA function in Salmonella choleraesuis remain unresolved, presenting important opportunities for future research:

Structural-Functional Relationships:

  • Subunit interactions: How does nuoA interact with other subunits to maintain complex integrity and function? Unlike the Na+-NQR complex studied in V. cholerae , the precise subunit arrangement and interaction network in S. choleraesuis remains poorly characterized.

  • Conformational dynamics: What conformational changes in nuoA occur during the catalytic cycle, and how do they contribute to proton translocation?

  • Membrane integration: How does nuoA's membrane topology influence its function in different lipid environments encountered during infection?

Regulatory Mechanisms:

  • Transcriptional control: What regulatory networks control nuoA expression in response to host environments and metabolic demands?

  • Post-translational modifications: Are there infection-specific modifications of nuoA that alter its function during pathogenesis?

  • Assembly regulation: What chaperones or assembly factors ensure proper incorporation of nuoA into functional respiratory complexes?

Pathogenesis Contributions:

  • Tissue-specific requirements: Does nuoA's contribution to pathogenesis vary across different host tissues and infection stages?

  • Host response interaction: How does nuoA-dependent metabolism influence host immune recognition and response?

  • Competitive advantage: What role does nuoA play in competition with host microbiota during infection establishment?

Evolutionary Considerations:

  • Host adaptation: How has nuoA evolved specifically in S. choleraesuis compared to other Salmonella serovars to optimize host-specific metabolism?

  • Functional conservation: Which aspects of nuoA function are conserved across different bacterial pathogens, and which are unique to S. choleraesuis?

  • Selective pressures: What evolutionary forces have shaped nuoA sequence and function in S. choleraesuis?

Methodological Challenges:

  • In vivo activity measurement: How can we accurately measure nuoA-containing complex activity during actual infection processes?

  • Structural determination: What technical barriers must be overcome to obtain high-resolution structures of nuoA in its native complex?

  • Functional reconstitution: Can we develop systems to reconstitute purified nuoA into artificial membranes for detailed mechanistic studies?

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and infection biology to fully elucidate nuoA's role in S. choleraesuis physiology and pathogenesis.

How might systems biology approaches advance our understanding of nuoA in the context of S. choleraesuis metabolism?

Systems biology approaches offer powerful frameworks to contextualize nuoA function within the broader metabolic network of Salmonella choleraesuis, potentially revealing emergent properties and regulatory mechanisms:

Multi-omics Integration Strategies:

  • Comprehensive network reconstruction: Integrating transcriptomics, proteomics, and metabolomics data to position nuoA within global metabolic networks under various conditions. This builds on approaches used with other respiratory components like the Na+-NQR in V. cholerae .

  • Flux balance analysis with experimental validation: Developing genome-scale metabolic models incorporating nuoA function, validated through 13C-metabolic flux analysis to quantify shifts in central carbon metabolism upon nuoA perturbation.

  • Protein-protein interaction networks: Using proximity labeling techniques (BioID, APEX) to identify novel interaction partners of nuoA beyond known respiratory complex components.

Temporal and Spatial Resolution:

  • Time-resolved transcriptomics: Capturing dynamic changes in gene expression following nuoA perturbation to identify direct and indirect regulatory consequences.

  • Spatial metabolomics: Mapping metabolite distributions in S. choleraesuis colonies and infected tissues to understand how nuoA contributes to metabolic microenvironments.

  • Single-cell analysis: Investigating population heterogeneity in respiratory function and its consequences for bacterial fitness and evolution.

Computational Modeling Approaches:

  • Multi-scale modeling: Integrating molecular dynamics simulations of nuoA structure with whole-cell metabolic models to connect atomic-level events to system-wide phenotypes.

  • Machine learning for pattern recognition: Identifying subtle metabolic signatures associated with nuoA variants that might not be apparent through traditional analysis.

  • Stochastic modeling: Accounting for intrinsic biological noise in respiratory chain function and its consequences for population-level behaviors.

Integration with Host-Pathogen Interfaces:

  • Dual RNA-seq during infection: Simultaneously capturing transcriptional changes in both S. choleraesuis and host cells to understand nuoA's role in host-pathogen metabolic crosstalk.

  • Interspecies metabolic modeling: Developing combined host-pathogen metabolic models to identify critical exchange points influenced by nuoA activity.

  • Microbiome interactions: Modeling how nuoA-dependent metabolism influences competitive fitness within host-associated microbial communities.

Predicted System-Level Impacts of nuoA Perturbation:

Biological SystemPrimary EffectsSecondary EffectsTertiary Effects
Energy MetabolismAltered proton motive forceReconfiguration of ATP synthesisGlobal changes in energy-demanding processes
Redox HomeostasisShifted NADH/NAD+ ratioAltered flux through central metabolismModified susceptibility to oxidative stress
Virulence ExpressionChanged metabolic sensingAltered virulence gene expressionModified host interaction patterns
Stress ResponsePerturbed electron transportActivated alternative respiratory pathwaysMetabolic adaptations to maintain viability
Host RecognitionChanged extracellular electron carrier statesModified surface structure expressionAltered PAMP presentation and immune activation

These systems biology approaches would transform our understanding of nuoA from a single component to an integrated element within the complex adaptive system of bacterial metabolism during host interaction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.