Recombinant Salmonella choleraesuis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request based on availability.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize development based on your request.
Synonyms
nuoK; SCH_2319; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
nuoK
Target Protein Sequence
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are moved across the cytoplasmic membrane), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: sec:SCH_2319

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase in Salmonella species?

NADH-quinone oxidoreductase (NDH-1) serves as the primary mobile electron carrier in the aerobic respiratory chain of Salmonella. This complex catalyzes the transfer of electrons from NADH to quinones (primarily ubiquinone under aerobic conditions), coupled with proton translocation across the membrane. This process generates the proton motive force needed for ATP synthesis . In Salmonella, this respiratory enzyme is crucial for energy production under various growth conditions and contributes significantly to bacterial fitness and survival. The complex can utilize different electron acceptors depending on environmental conditions, with ubiquinone predominating during aerobic respiration and alternative quinones like demethylmenaquinone and menaquinone functioning during anaerobic respiration .

What experimental approaches can distinguish between NDH-1 and NDH-2 activity in Salmonella?

Researchers can differentiate NDH-1 (encoded by nuo genes) from the alternative NADH:quinone oxidoreductase NDH-2 (encoded by the ndh gene) through multiple experimental approaches:

  • Substrate specificity: NDH-1 can catalyze electron transfer from deamino-NADH (dNADH), while NDH-2 cannot. Using dNADH as a substrate allows specific measurement of NDH-1 activity .

  • Spectrophotometric assays: dNADH oxidation can be measured by decreased absorption at 340 nm in membrane fractions. This assay can be performed under various conditions:

    • dNADH-oxidase activity: Using potassium phosphate buffer with EDTA

    • dNADH-quinone reductase activity: Including KCN and specific quinones like DB (2,3-dimethoxy-5-methyl-6-decyl-1,4-benzoquinone)

    • dNADH-K₃Fe(CN)₆ reductase activity: Using ferricyanide as electron acceptor and measuring at 420 nm

  • Inhibitor studies: Specific inhibitors like capsaicin-40 can be used to confirm NDH-1 involvement in the measured activities .

Table 1. Spectrophotometric Assays for NDH-1 Activity

Assay TypeComponentsMeasurementExtinction Coefficient
dNADH-oxidase10 mM potassium phosphate buffer (pH 7.0), 1 mM EDTA, 0.15 mM dNADHDecreased absorption at 340 nmε₃₄₀ = 6220 M⁻¹ cm⁻¹
dNADH-DB reductaseAbove components + 10 mM KCN, 50 μM DBDecreased absorption at 340 nmε₃₄₀ = 6220 M⁻¹ cm⁻¹
dNADH-K₃Fe(CN)₆ reductaseAbove components with 1 mM K₃Fe(CN)₆ instead of DBReduction at 420 nmε₄₂₀ = 1040 M⁻¹ cm⁻¹

What are the optimal expression systems for producing recombinant Salmonella choleraesuis nuoK?

While the search results don't specifically address nuoK expression systems, we can draw insights from related recombinant Salmonella work. For expressing Salmonella membrane proteins like nuoK, researchers should consider:

  • Balanced expression systems: Since nuoK is a membrane protein, overexpression could overwhelm the membrane insertion machinery. Expression systems with tunable promoters (like araBAD) allow titration of expression levels.

  • Complementation approaches: For functional studies, expressing nuoK in nuoK-deletion mutants provides the most relevant cellular context. This approach can utilize plasmid-based complementation systems similar to those used for other Salmonella genes, such as the Asd+ plasmid system demonstrated with other recombinant Salmonella constructs .

  • Heterologous expression considerations: When expressing nuoK in non-native hosts (e.g., E. coli expression strains), codon optimization may improve yields, and fusion tags (His, FLAG, etc.) can facilitate purification while potentially preserving function.

The methodology should include proper controls to verify expression, including immunoblotting against the target protein or epitope tags, and functional assays to confirm that the recombinant protein retains native activity within the NDH-1 complex .

How can gene deletion and complementation be used to study nuoK function?

A systematic approach to study nuoK function would involve:

  • Generation of deletion mutants: Create a clean nuoK deletion in Salmonella choleraesuis using lambda Red recombination or similar techniques. This parallels the approach used for other genes like ubiA and ubiE described in the literature .

  • Phenotypic characterization: Assess the impact of nuoK deletion on:

    • Growth in different media and carbon sources (e.g., L-malate)

    • Motility in soft agar

    • Respiratory chain function using enzyme activity assays

    • Quinone composition analysis by reversed-phase HPLC

  • Complementation testing: Reintroduce the nuoK gene on a plasmid under native or controlled promoters to confirm that observed phenotypes are specifically due to nuoK loss. The complementation plasmid can be modeled after systems like the Asd+ plasmid system mentioned in the search results .

  • Site-directed mutagenesis: Create specific nuoK point mutations to identify critical residues, similar to the approach that identified important mutations in nuoG (Q297K), nuoM (A254S) and nuoN (A444E) in the context of ubiquinone biosynthesis mutant suppression .

This approach systematically establishes the specific contribution of nuoK to Salmonella physiology and NDH-1 function through genetic manipulation and functional restoration.

What experimental designs are most appropriate for investigating nuoK interactions with other NDH-1 subunits?

The investigation of protein-protein interactions within multi-subunit complexes like NDH-1 requires specialized experimental approaches. For studying nuoK interactions:

  • Cross-linking coupled with mass spectrometry:

    • In vivo or in vitro cross-linking of assembled NDH-1 complexes

    • Digestion and analysis by liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Identification of cross-linked peptides reveals proximity relationships

    • This non-experimental quantitative approach allows analysis of complex protein interactions without disrupting native structure

  • Co-immunoprecipitation with tagged subunits:

    • Express epitope-tagged nuoK in Salmonella

    • Immunoprecipitate using anti-tag antibodies

    • Analyze co-precipitating proteins by immunoblotting or mass spectrometry

    • Confirm interactions by reverse co-IP with antibodies against partner subunits

  • Bacterial two-hybrid or split-GFP complementation assays:

    • Test binary interactions between nuoK and other NDH-1 subunits

    • Quantify interaction strength through reporter gene expression

  • Comparative analysis of suppressor mutations:

    • Similar to the approach that identified suppressor mutations in nuoG, nuoM, and nuoN in ubiquinone biosynthesis mutants

    • Screen for suppressors of nuoK deletion phenotypes

    • Sequence analysis to identify compensatory mutations in interacting subunits

These approaches complement each other to build a comprehensive interaction map for nuoK within the NDH-1 complex.

How can researchers effectively measure the impact of nuoK mutations on electron transfer efficiency?

To quantitatively assess how nuoK mutations affect NDH-1 electron transfer:

  • Enzyme activity assays with membrane fractions:

    • Prepare membrane fractions from wild-type, nuoK mutant, and complemented strains

    • Measure dNADH oxidation rates using spectrophotometric assays

    • Compare dNADH-oxidase, dNADH-DB reductase, and dNADH-K₃Fe(CN)₆ reductase activities

  • Oxygen consumption measurements:

    • Use oxygen electrodes to measure respiratory rates in intact cells

    • Compare rates with different substrates to isolate NDH-1 contribution

    • Calculate respiratory control ratios to assess coupling efficiency

  • Membrane potential measurements:

    • Use fluorescent probes like DiSC3(5) to measure membrane potential

    • Assess the proton pumping efficiency of nuoK variants

  • Quinone pool analysis:

    • Use reversed-phase HPLC to quantify quinone species (ubiquinone, menaquinone, demethylmenaquinone)

    • Assess how nuoK mutations affect quinone reduction states and total pool size

Table 2. Comparison of Methods for Assessing Electron Transfer Efficiency

MethodMeasuresAdvantagesLimitations
Enzyme activity assaysElectron transfer rates from NADH to specific acceptorsDirect quantification of specific activitiesRequires membrane isolation
Oxygen consumptionIntegrated respiratory activityCan be performed with intact cellsMultiple pathways contribute
Membrane potentialProton pumping efficiencyDirectly related to energy conservationIndirect measure of electron transfer
Quinone analysisRedox state of electron carriersProvides information on intermediate carriersTechnically challenging

What non-experimental quantitative approaches can complement laboratory investigations of nuoK function?

Non-experimental quantitative methods provide valuable context and insights that can guide and enhance experimental research on nuoK:

  • Comparative genomics analysis:

    • Sequence alignment of nuoK across Salmonella serovars and related species

    • Identification of conserved residues suggesting functional importance

    • Analysis of co-evolution patterns with other NDH-1 subunits

    • This comparative approach helps identify functionally important features without direct experimentation

  • Structural bioinformatics:

    • Homology modeling of nuoK based on related structures

    • Molecular dynamics simulations to predict conformational changes

    • Computational docking to predict interactions with other subunits

    • In silico mutagenesis to predict effects of specific residue changes

  • Systems biology modeling:

    • Integration of nuoK into genome-scale metabolic models of Salmonella

    • Flux balance analysis to predict systemic effects of nuoK perturbation

    • Development of kinetic models of the NDH-1 complex

  • Analysis of existing datasets:

    • Mining transcriptomic and proteomic data for nuoK expression patterns

    • Correlation analysis to identify genes with similar expression profiles

    • Meta-analysis of phenotypic data from related mutants

These non-experimental approaches can generate hypotheses for subsequent experimental testing and help contextualize experimental findings within broader biological systems .

How should researchers address conflicting results between different assays measuring NDH-1 activity?

When faced with conflicting NDH-1 activity measurements, researchers should implement:

  • Systematic validation across multiple assay systems:

    • Cross-validate findings using the complementary assays described in section 4.2

    • Compare results from both in vitro enzyme assays and in vivo cellular measurements

    • Identify patterns in where discrepancies occur to determine assay-specific limitations

  • Control experiments to identify interference factors:

    • Test for inhibitor specificity issues (e.g., off-target effects of capsaicin-40)

    • Evaluate contribution of alternative enzymes (e.g., NDH-2) using genetic knockouts

    • Assess matrix effects from different membrane preparation methods

  • Statistical analysis approaches:

    • Apply appropriate statistical tests to determine if differences are significant

    • Consider using multivariate analysis to identify patterns across multiple measurements

    • Calculate effect sizes to quantify the magnitude of differences beyond p-values

  • Reconciliation strategies:

    • Consider physiological relevance of different assay conditions

    • Develop integrated models that account for assay-specific biases

    • Transparently report all results, even when conflicting, with appropriate context

When researchers encountered reduced dNADH-oxidase activities in ubiquinone biosynthesis mutants (19% to 90% of wild-type), they compared these results with other assays and growth conditions to develop a coherent understanding of respiratory chain adaptation .

What statistical approaches are most appropriate for analyzing the effects of nuoK mutations on bacterial fitness?

For rigorous statistical analysis of nuoK mutation effects on fitness:

  • Growth curve analysis:

    • Fit growth curves to appropriate models (logistic, Gompertz, etc.)

    • Extract parameters like maximum growth rate, lag phase, and carrying capacity

    • Apply ANOVA or mixed-effects models to compare strains

    • Include post-hoc tests with appropriate corrections for multiple comparisons

  • Competition assays:

    • Calculate fitness coefficients from changes in strain ratios over time

    • Apply bootstrapping to generate confidence intervals

    • Use linear mixed models to account for experimental batch effects

  • Survival analysis for stress conditions:

    • Apply Kaplan-Meier estimates for time-to-death curves

    • Use Cox proportional hazards models for comparing survival profiles

    • Incorporate time-dependent covariates when stress conditions change

  • Multivariate approaches for complex phenotypes:

    • Principal component analysis to identify major sources of variation

    • Hierarchical clustering to identify mutation groups with similar effects

    • Partial least squares discriminant analysis to link genetic changes to phenotypic outcomes

These approaches provide statistically robust frameworks for interpreting complex phenotypic data resulting from nuoK mutations, helping researchers distinguish significant biological effects from experimental noise.

How can researchers distinguish between direct effects of nuoK mutations and secondary adaptations in long-term experiments?

Differentiating primary effects from adaptive responses requires:

  • Time-course sampling strategies:

    • Implement immediate phenotyping after genetic manipulation

    • Sample at multiple time points to track progressive adaptations

    • Compare acute vs. chronic effects of mutations

  • Suppressor mutation analysis:

    • Perform whole genome sequencing of adapted strains

    • Identify secondary mutations that arise during adaptation

    • Construct strains with combinations of primary and suppressor mutations to test interactions

  • Controlled evolution experiments:

    • Compare multiple independent lineages of the same nuoK mutant

    • Identify convergent adaptive pathways

    • Reintroduce wild-type nuoK at different time points to test reversibility

  • Transcript and protein profiling:

    • Analyze global expression changes at early and late time points

    • Identify regulatory responses triggered by the nuoK mutation

    • Track changes in other respiratory complex components

This approach parallels how researchers distinguished primary effects of ubiquinone biosynthesis disruption from secondary suppressors that emerged in nuo genes, revealing that suppressor mutations specifically improved electron flow activity under certain growth conditions .

What are the most common pitfalls when attempting to express and purify recombinant membrane proteins like nuoK?

Membrane protein expression and purification present specialized challenges:

  • Expression level optimization:

    • Challenge: Toxic accumulation in membrane when overexpressed

    • Solution: Use tunable promoters and optimize induction conditions

    • Validation: Monitor growth curves during induction and protein yield

  • Membrane extraction efficiency:

    • Challenge: Incomplete solubilization from membranes

    • Solution: Screen multiple detergents (DDM, LMNG, SMA polymers)

    • Validation: Quantify protein in membrane and solubilized fractions

  • Maintaining protein stability:

    • Challenge: Rapid degradation after extraction from native membrane environment

    • Solution: Include stabilizing lipids and optimize buffer composition

    • Validation: Thermal stability assays with differential scanning fluorimetry

  • Assessing functional integrity:

    • Challenge: Difficult to confirm native folding of isolated subunits

    • Solution: Develop activity assays applicable to the isolated protein

    • Validation: Structural analysis methods (circular dichroism, limited proteolysis)

  • Aggregation during concentration:

    • Challenge: Protein aggregation during concentration steps

    • Solution: Add glycerol or sucrose, maintain critical micelle concentration

    • Validation: Dynamic light scattering to monitor particle size distribution

These considerations are essential when working with membrane proteins like nuoK, which may require specialized approaches different from those used for soluble proteins.

How can researchers troubleshoot inconsistent phenotypes in nuoK mutant strains?

When nuoK mutants show variable phenotypes:

  • Genetic background verification:

    • Challenge: Unintended secondary mutations or differences in strain backgrounds

    • Solution: Whole genome sequencing of multiple isolates, complementation testing

    • Example: The study of ubiquinone biosynthesis mutants revealed that suppressor mutations in nuo genes could dramatically affect phenotypes

  • Growth condition standardization:

    • Challenge: Environmental variations affecting respiratory chain requirements

    • Solution: Strictly control media composition, oxygen levels, and growth phase

    • Example: Suppressor mutations improved electron flow activity only under certain growth conditions

  • Quinone pool compensation:

    • Challenge: Adaptive changes in quinone composition masking phenotypes

    • Solution: Analyze quinone pool by HPLC, construct double mutants in quinone biosynthesis

    • Example: Strains with ubiA deletion produced alternative quinones (demethylmenaquinone and menaquinone) that partially compensated for ubiquinone loss

  • NDH-1 complex stability assessment:

    • Challenge: Variable assembly or stability of the complex without nuoK

    • Solution: Immunoblotting for other complex subunits, BN-PAGE analysis

    • Example: Immunoblotting revealed increased NDH-1 levels in ubiquinone-biosynthesis mutant strains

This systematic troubleshooting approach helps identify sources of variability and ensures reproducible phenotypic characterization of nuoK mutants.

What emerging technologies could advance our understanding of nuoK function and interactions?

Several cutting-edge approaches show promise for nuoK research:

  • Cryo-electron microscopy for structure determination:

    • High-resolution structures of complete bacterial NDH-1 complexes

    • Visualization of nuoK in different functional states

    • Structure-guided mutational analysis of key residues

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of subunit stoichiometry and stability

    • Identification of associated lipids and small molecules

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes

    • Optical tweezers to measure force generation during proton pumping

    • Single-complex activity measurements

  • In-cell structural biology:

    • Electron tomography to visualize respiratory complexes in situ

    • Cellular cryo-electron microscopy to capture native arrangements

    • Cross-linking mass spectrometry in intact cells

These technologies can provide unprecedented insights into nuoK's role within the NDH-1 complex, advancing beyond the limitations of current approaches.

How might research on nuoK contribute to broader understanding of bacterial respiratory chains and energy production?

The study of nuoK has implications for:

  • Evolutionary perspectives on respiratory chain diversity:

    • Comparative analysis across bacterial species

    • Understanding adaptation to different energy sources

    • Insights into the evolution of proton-pumping mechanisms

  • Bacterial bioenergetics principles:

    • Quantitative understanding of electron transfer efficiency

    • Mechanistic models of proton translocation

    • Energy conservation strategies under different conditions

  • Metabolic engineering applications:

    • Optimization of electron transfer for biotechnology applications

    • Engineering respiratory chains for alternative electron donors/acceptors

    • Enhancing bacterial survival in diverse environments

  • Antimicrobial development insights:

    • Identification of respiratory chain vulnerabilities

    • Understanding how disruption of energy production affects virulence

    • Potential targets for species-specific inhibitors

Research on nuoK and other NDH-1 components provides fundamental insights into bacterial energy metabolism that have both theoretical significance and practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.