Recombinant Salmonella choleraesuis p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
aaeA; SCH_3303; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: sec:SCH_3303

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biological role of the p-hydroxybenzoic acid efflux pump subunit AaeA in Salmonella choleraesuis?

The p-hydroxybenzoic acid efflux pump subunit AaeA is part of a bacterial efflux system that facilitates the transport of aromatic carboxylic acids, such as p-hydroxybenzoic acid, out of the cell. Efflux pumps like AaeA play a critical role in bacterial survival by maintaining intracellular homeostasis and protecting against toxic compounds. In Salmonella choleraesuis, the AaeA protein contributes to the organism's ability to resist environmental stressors and antimicrobial agents, thereby enhancing its virulence and adaptability .

Efflux pumps are typically classified into families based on their energy sources and structural characteristics. AaeA belongs to the major facilitator superfamily (MFS), which utilizes proton motive forces for substrate translocation . This mechanism is pivotal for bacterial resistance against antibiotics and other inhibitory substances.

How is recombinant AaeA protein expressed and purified?

Recombinant AaeA protein is typically expressed in Escherichia coli systems using plasmid vectors that encode the full-length gene for AaeA fused with tags such as His-tags for purification purposes . The protein is expressed as a lyophilized powder and purified to a high degree (greater than 90% purity) using techniques like SDS-PAGE analysis .

The purification process involves reconstitution in sterile water with additives such as glycerol to stabilize the protein during storage. The recommended storage conditions include temperatures of -20°C or -80°C to prevent degradation . These protocols ensure that recombinant AaeA retains its functional integrity for experimental applications.

What experimental assays are used to evaluate the activity of recombinant AaeA?

The activity of recombinant AaeA can be assessed using assays that measure its ability to transport substrates across bacterial membranes. Common methodologies include:

  • Efflux Assays: These involve monitoring the extrusion of fluorescent or radiolabeled substrates from bacterial cells expressing AaeA.

  • Minimum Inhibitory Concentration (MIC) Tests: These tests determine the concentration of antimicrobial agents required to inhibit bacterial growth in strains expressing recombinant AaeA .

  • Live/Dead Staining: This assay assesses bacterial viability after exposure to stressors or inhibitors targeting efflux pumps .

These methods provide insights into the functional dynamics of AaeA and its role in bacterial resistance mechanisms.

How does AaeA contribute to antibiotic resistance in Salmonella choleraesuis?

The efflux pump subunit AaeA plays a significant role in mediating antibiotic resistance by actively expelling antimicrobial agents from bacterial cells. This mechanism reduces intracellular drug concentrations, thereby diminishing their efficacy . Studies have shown that efflux pumps like AaeA can transport a wide range of substrates, including antibiotics, biocides, and metabolic byproducts.

In addition to direct antibiotic resistance, efflux pumps contribute to biofilm formation, virulence enhancement, and survival under hostile conditions such as bile exposure in enteric bacteria . These multifaceted roles underscore the importance of targeting efflux pumps like AaeA in developing strategies to combat multidrug-resistant pathogens.

What are the challenges in studying efflux pump inhibitors (EPIs) targeting AaeA?

  • Selectivity: EPIs must specifically target bacterial efflux pumps without affecting eukaryotic counterparts due to structural similarities across species .

  • Resistance Development: Continuous exposure to EPIs can lead to mutations in efflux pump genes, resulting in reduced inhibitor effectiveness .

  • Pharmacokinetics: EPIs require favorable absorption, distribution, metabolism, excretion, and toxicity (ADMET) profiles to be viable therapeutic agents .

Addressing these challenges necessitates innovative approaches such as structure-based drug design and high-throughput screening of compound libraries.

How does environmental stress influence the expression of AaeA?

Environmental stressors such as exposure to aromatic carboxylic acids or antibiotics can upregulate the expression of efflux pumps like AaeA . Gene regulation studies have identified transcriptional activators that respond to these stimuli by enhancing efflux pump activity.

For instance, regulatory proteins encoded upstream of efflux pump genes interact with promoter regions under stress conditions, initiating transcriptional cascades that boost efflux capacity . This adaptive response underscores the evolutionary significance of efflux systems in bacterial survival.

What experimental controls are essential when studying recombinant AaeA?

When investigating recombinant AaeA, it is crucial to include appropriate controls to ensure data reliability:

  • Negative Controls: Bacterial strains lacking efflux pump genes serve as baseline comparisons.

  • Positive Controls: Strains expressing known efflux pumps validate assay sensitivity.

  • Substrate Specificity Tests: Using various substrates helps delineate the range of compounds transported by AaeA.

These controls mitigate experimental biases and enhance data interpretation.

How can computational modeling aid in understanding AaeA function?

Computational modeling provides valuable insights into the structural dynamics and substrate specificity of efflux pumps like AaeA. Techniques such as molecular docking simulate interactions between substrates and pump binding sites, revealing key residues involved in transport mechanisms .

Additionally, molecular dynamics simulations elucidate conformational changes during substrate translocation, offering a deeper understanding of energy coupling processes within MFS transporters like AaeA.

How should researchers address contradictory findings related to AaeA activity?

Contradictory data often arise due to variations in experimental conditions or strain-specific differences in efflux pump expression levels. To resolve these discrepancies:

  • Standardize assay protocols across studies.

  • Employ genetic sequencing to identify mutations affecting pump function.

  • Use complementary techniques such as transcriptomics or proteomics for holistic analyses.

These strategies enable researchers to reconcile conflicting results and advance knowledge on efflux systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.